KEGG   Xenopus laevis (African clawed frog): 496325Help
Entry
496325            CDS       T01010                                 

Gene name
rxrg, RXR-gamma, RXRgamma, nr2b3, xrxrg
Definition
retinoid X receptor, gamma
Orthology
K08526  
retinoid X receptor gamma
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
PPAR signaling pathway
Adipocytokine signaling pathway
Class
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:xla04920]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:xla03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 470 aa AA seqDB search
MHLATETAPSMATYSSTYFNSPLHAHSTSVSSSNLAAMNSLDTHPGYMGNSLNGPRSMTT
NMNSMCSPGNNIGPPYRVIASSMGPHSLPSPTILNYPGHESPPFNILNNVSCSEDIKPPP
GLSSLGSPCMNNYSCNSPGALTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLVY
TCRDSKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRSREKSDTEAESTSSTSEE
MPVERILEAELAVDPKIEAFGDAGLPNSTNDPVTNICHAADKQLFTLVEWAKRIPYFSDL
PLEDQVILLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHNAGVGSIFDRVLTE
LVSKMKDMDMDKSELGCLRAIVLFNPDAKGLSNAAEVEALREKVYATLESYTKQKYPDQP
GRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDIFLMEMLETPHQIS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgcatcttgctactgagacagctccatccatggctacgtactcctccacttacttcaat
tctcctcttcatgcacattcaacgtcagtcagctcctctaatctggcagcgatgaattct
ctagatacgcacccaggatacatgggaaattctcttaatggccccaggtctatgacaaca
aatatgaattctatgtgctctccaggcaacaacatcggccctccatacagagtgattgca
tcttccatgggaccacactccctgccttctccaacaatcctcaattaccctggccatgag
agtccaccatttaacatcctgaacaatgtaagctgctcggaagacataaagcctccacca
ggtctaagcagccttgggagtccatgcatgaacaattattcctgcaacagcccaggggca
ttaaccaaacacatctgtgccatctgtggggacaggtcctcaggcaaacattatggggtg
tacagttgtgaaggatgcaaaggttttttcaaacgcacaataaggaaagatttggtttac
acatgtcgagacagcaaagactgcttgattgacaagcgtcagcgtaatcgctgccagtat
tgccggtatcagaagtgtctagccatgggtatgaagcgggaagcagtccaagaggagagg
caaagaagccgagagaaaagtgatacagaggcagaatctactagcagtacaagtgaggaa
atgccagtggagagaattctggaagcagagctggcagtggatccaaagatagaagcattt
ggagacgctggattgccaaattctacaaatgacccagtcaccaatatatgccacgccgca
gacaagcagctctttactctggttgaatgggcgaaaagaattccatatttttcagatttg
cctttagaagaccaagtcattctgctgcgagcaggttggaatgagttactgattgcttcc
ttctcgcaccgctcagtgtctgtgcaggatggcattcttctggctactgggttacatgtg
cacagaagcagcgcacacaatgcaggagtaggctctatctttgacagggtgctaactgag
ttggtttctaaaatgaaagacatggacatggataaatcagagctgggatgcctgagagct
attgttctgtttaatccagatgctaagggcctgtccaatgctgcagaggttgaagcactg
cgtgaaaaagtctatgccactcttgaatcctacaccaagcaaaagtacccagaccaacca
ggaaggtttgcaaaattactgttaagacttccagctttgagatctattggacttaaatgc
ctggagcaccttttcttcttcaagctcattggagacacccccattgatatattccttatg
gagatgctagaaacacctcaccagatctcatga

DBGET integrated database retrieval system