KEGG   Xenopus laevis (African clawed frog): 496354Help
Entry
496354            CDS       T01010                                 

Gene name
elp3
Definition
elongator acetyltransferase complex subunit 3 (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     496354 (elp3)
Transfer RNA biogenesis [BR:xla03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    496354 (elp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 549 aa AA seqDB search
MKPDRGMRGNMSQAELMMMTVADVIKQLVEAHEQGKDVNLNKLKTKTSAKYGLSAQPRLV
DIIAAVPPQYRKILVPKLKAKPIRTASGIAVVAVMCKPHRCPHINFTGNICVYCPGGPDS
DFEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHNVDKVEFIVMGGTFMALP
EDYRDFFIRNLHDALSGHTSNSVSEAVRYSERSNTKCVGITIETRPDYCLKRHLSDMLCY
GCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLSKDAGFKVVSHMMPDLPNMGLERDI
EQFIEFFENPAFRPDGMKLYPTLVIRGTGLYELWKTGRYRSYSPSTLVDLVARILALVPP
WTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTECRDVRTREVGIQEIHHKVRPY
QVELIRRDYVANGGWETFLSYEDPEQDILIGLLRLRKCSEESFRPELKGGVSIVRELHVY
GSVVPISSRDPSKFQHQGFGMLLMEEAERIARDEHGSWKIAVISGVGTRNYYRKIGYELE
GPYMVKRLD
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggacagagggatgagggggaacatgagtcaggccgagctgatgatgatgacg
gtggctgatgtcattaagcagctggtggaggctcatgagcaggggaaggacgtcaatctg
aacaagttaaaaacaaaaacttcagccaagtacggcctctctgcgcagcctcgcctggtg
gatattatcgccgccgtcccccctcagtaccggaaaatactggtgcccaagttaaaagca
aagccaatcagaactgccagcgggatcgctgtggtcgctgttatgtgtaaaccccacaga
tgcccccacattaatttcactggcaacatctgcgtgtactgccccggggggcctgattct
gactttgaatactcgacacaatcatatacaggatacgagccaacatcaatgagagccatc
cgtgctcggtacgacccctatctacagaccagacatcgagtggaacagctgaagcaattg
ggccacaacgtggacaaggtggagtttattgttatgggcggaacgttcatggccctacct
gaggattacagagacttcttcatccggaatctgcacgatgccttgtctggtcacacgtcc
aacagcgtctcggaggcagtccgatattctgaaaggagcaataccaagtgtgtgggcatc
accattgaaaccaggccagattattgcctcaagcgccacctgagtgacatgttgtgctac
ggttgcaccagacttgagatcggagtgcaaagtgtgtatgaagatgtggccagagataca
aacaggggccacacagtgaaagccgtttgcgagtccttccacctgtccaaagacgcggga
tttaaagtggtttcccacatgatgccagacctgcccaacatgggactggagagagacatt
gagcagtttattgagttctttgaaaaccctgctttccgcccagatgggatgaagctgtat
ccaacattggtgatccgtggcactggtctttacgagctctggaaaacaggacgatatagg
agttactccccgagcaccctggtggatttggtggcaaggattttggcccttgtgccaccg
tggacacgagtttacagagtacagagggatataccaatgccactagtaagctctggggtg
gagcacggtaacctgagggaattggcattagccagaatgaaagatttgggcactgagtgt
cgggatgtaagaacacgagaagtgggaatccaagaaattcatcacaaagtcagaccctat
caggttgagttaattcgtagagattatgttgccaacggagggtgggagacatttttatct
tatgaagatcctgagcaagacatacttattggcctcctgcggctgaggaaatgttcagaa
gagtccttcaggcccgagctcaagggaggtgtctctattgtacgggaactccatgtatat
ggcagcgtggttcccatcagcagccgtgacccttctaagttccaacatcaggggtttggg
atgttgctgatggaggaagcagagcgcatagcaagagatgaacatggttcctggaaaatt
gctgttatttcaggtgtcgggacaaggaactattacagaaaaattggttatgaattagaa
gggccgtacatggtgaagagactggactga

DBGET integrated database retrieval system