KEGG   Xenopus laevis (African clawed frog): 595046Help
Entry
595046            CDS       T01010                                 

Definition
uncharacterized LOC595046
Orthology
K03357  
anaphase-promoting complex subunit 10
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    595046
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    595046
   04114 Oocyte meiosis
    595046
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    595046
Ubiquitin system [BR:xla04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     595046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 185 aa AA seqDB search
MTTPNKTPPGADPNQLKRTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQ
PHLVNIQFRRKTTVKALCVYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWI
HVPLTDAHKKPIRTFMIQIAVLANHQNGRDTHMRQIKVFTPVEESSIGRFPRCTTIDFMM
HRFIR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacccaacaaaactcccccaggcgctgatcctaaccagctgaaaaggactggc
actgttcgagaaataggctcacaagctgtttggtctttgtcatcctgtaaaccagggttt
ggagttgatcagttacgagatgacaatttagaaacctactggcagtcagatggatcacag
cctcatttagtcaacatccagtttcgaaggaagacaaccgttaaagctttgtgcgtttat
gctgattacaaatcagatgagagttatactccaagtaaaatatccgtccgagtgggaaat
aactttcacaacctccaagagattcggcaactggaactggtggaacctagcggatggata
catgttcctctaactgatgcccataaaaagccaattcggacctttatgattcagattgct
gttttggccaaccatcagaatgggagagatactcacatgaggcaaatcaaagtgtttaca
ccagtagaagaaagctcaattggcaggtttcccagatgtaccaccattgattttatgatg
catcgcttcatcaggtga

DBGET integrated database retrieval system