KEGG   Xenopus laevis (African clawed frog): 733154Help
Entry
733154            CDS       T01010                                 

Gene name
uchl5
Definition
ubiquitin carboxyl-terminal hydrolase L5 (EC:3.4.19.12)
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     733154 (uchl5)
Peptidases [BR:xla01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   733154 (uchl5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 329 aa AA seqDB search
MAGSAGEWCLMESDPGVFTELIKGFGCRGIQVEEIWSLEQEHFVDLQPVQGLIFLFKWQP
GEEPAGSVVQDSRLDTIFFAKQVINNACATQAIISILLNTTHNDVHLGETLSEFKEFTQS
FDAAMKGLALSNSEVIRQVHNSFARQQMFEFDAKSTTKDDDAFHFVSYVPVNGRLYELDG
LKDGPIDLGPCKEDDWISAARPVIEKRMQKYCEGEIRFNLMAIVSDRKKIYEQKIADLQR
RIAEEEPMDTDQGSTLLSSMQSEIAKYQLLIEEEKQKMKRYKVENIRRKHNYLPFIMELL
KTLAEHQQLIPLVEKAKEKHNTRRAQEAK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcagtgcaggagaatggtgcctgatggagagcgaccccggcgtgttcaccgaa
ctgatcaaagggtttggatgccgaggtattcaagtagaagaaatctggagtctggaacaa
gaacactttgtagacttgcaaccagtgcaaggattaatctttctcttcaagtggcagcca
ggagaggaaccagctggctctgttgttcaagactccaggctggacacaatcttttttgcg
aaacaggtaataaacaatgcatgtgcaacacaagcaatcatcagtattttgctaaacacc
acacacaatgatgtacatttaggagaaactctgtctgaattcaaagaattcacccaaagc
tttgatgcagctatgaaaggactggctctaagcaattccgaagtgatccgtcaagtacac
aacagttttgccaggcaacaaatgtttgagtttgatgcaaaatccacaacgaaggatgat
gatgcatttcactttgtcagctacgtgccagtcaacgggaggctttacgaactggacggt
ttaaaggatggaccaattgatttaggaccatgtaaggaagacgattggatcagtgcagct
agacctgttatagagaaacgaatgcagaagtactgtgaaggtgagatacggttcaatttg
atggctattgtgtcagacagaaagaagatctacgagcagaagattgcagatttgcagagg
cgaattgcagaggaagagcctatggacacagaccagggcagcactctgctgagctccatg
cagtcggaaatcgcaaaataccagctgcttatagaagaagagaaacaaaagatgaaaaga
tacaaggttgaaaatatcagaagaaaacataactaccttccattcatcatggagttgctg
aagactctagcagagcatcagcagttaataccattagtagaaaaggccaaagagaaacac
aacacaaggagggctcaggaagccaaatga

DBGET integrated database retrieval system