KEGG   Xenopus laevis (African clawed frog): 733168Help
Entry
733168            CDS       T01010                                 

Gene name
pom121-a
Definition
POM121 membrane glycoprotein a
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:xla03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1050 aa AA seqDB search
MEGGCCWDLVKRIQPIALPLALSLVTCALAYIYNQLTVAGLLLASCWTYRSSGRRFIVWK
WLTGPRLVASTKKLRNSTDWRLQSPPVSLLEGSPSPLSLNMGTYMNKQELPARGEACGPR
AIKEKLSRPNPSVATPIRRLSFRDPLSSSNRTYLCARRDYPLKQEIYSKPGSLPRVSLDG
QSQQRVPLTPRHFTRRTPVKISPQDLKTRFQLAPQPNVVSSPHLDFEQEPCLPSIYHRVE
HETSVTHSRHLLEPEQYPASPSSHKANTFEATFSSHHVEDPCATESVLRALKECLKRKRI
RDEDSEDTENKRRKENGEESKLLVNDSLCRTSKMEASRASWRSESSSMENLSQQSSISIQ
DMLNEVQNSKNSDGKVSPASSFNLENLSKRKIITVPGHNEITSSLSSSRYLQKKKRSLEI
PRCDTPEWPIKKMRKDRLETSMSPSQETMKTQMSETQKVEVNPSPVQLHKPKGNLPWKRN
VHLICPEHPEEFYRLPPGPIPGYNVTQADYDAAKEAAQQRFLRLFQEPSAPSVPSASESC
SKQVSLTLQTSTSPDKSFQAVNEKPNISAANTTFTLFSSSSDAKSVTSSSSTPSPFTSAT
TSITNTLLQSLGSGQTKSESPFPKNSLLQILGKTEGNNSQPMFNPVFGPLGSANPSPVTA
APGLSTTTTAILKPICGDPPSQQAQTSMFKPIFEPPSSQTVPSALSSPFVFSSSSSTTST
TSFLGTTGNSVNTGKHEKPNLALTTCASNTTITSSLAPTFGITSKVEPVSLGGPASQANT
SFSVIGSTSVPAISTAFGSTTSAFTAAGQTANPSFSANTAPIGVSSVSASEGQTSISTTA
TFSKFGVPVGQNVFSASNPFGSGTQSTMGTSTQSATNIAFSFGTSTSTQSAFGFSQNPTM
LFSSSTKSNNPTNTSGFNSMGSVFGSSTVPTSSIVTPNKSLSTLGIPEKCETKNQLVTNQ
LSLGQGSTPAPFPSIMPTQSFVSSSTSFAPSTPTVNQSSTPGSFPSMAAVQPFTSPSSPA
AGFFSHGTAPKSRTAVRHKLHPRRPHPRKK
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atggaagggggctgctgctgggacttggttaagcggatacagcccattgcacttcctctg
gccttgtcccttgtaacgtgcgctttggcatatatctataatcagcttactgtagccggc
ctgcttctagccagttgctggacctacaggagctcagggaggcggtttattgtgtggaag
tggctcacaggccccagactagtggcaagcacgaaaaagctgcgcaacagcactgactgg
aggctgcagagtccaccggtgtcgctgctggagggaagcccgtctcccttgtctctgaac
atgggcacgtacatgaacaagcaagagcttcctgctagaggagaggcctgcgggcccaga
gctatcaaggagaagctgagccgacccaatccctcggtggcgacccctatcaggcgtctg
tctttcagggacccactttcttcgtccaaccgaacctatttgtgtgctcgaagggattat
ccccttaaacaagaaatctatagcaagccaggatctctgccaagggtttctttagatgga
caatcgcagcagagagtgccactgacacccaggcactttactagaaggacccctgtaaaa
atttcccctcaggatctgaaaaccagatttcagttggctccacagccaaatgtggtatca
tcccctcatcttgactttgagcaagaaccatgtttgccatccatctatcatcgcgtagaa
catgaaaccagtgtgacacattctcgccatctactggaaccagagcaatatccagcatcc
ccctctagtcataaagcaaacacttttgaggctactttctccagtcatcacgttgaagat
ccatgtgctacagagtctgttcttagagccctcaaagaatgtttaaagagaaaaagaatt
cgagatgaggactctgaagatactgaaaacaagagacggaaggaaaatggggaagaaagt
aagctgcttgtcaatgattccttgtgcagaacttctaagatggaagccagtcgggcaagt
tggagatctgaatccagttctatggagaatctgtcccagcagtcatccatttccattcag
gacatgttgaatgaagtacaaaattccaaaaacagtgacggcaaagtctctcccgcctcc
tcattcaatttggagaatttatcaaaacgaaagattatcacggtgcctggtcataatgaa
atcaccagctccttgagctccagcagatatctgcagaaaaaaaagagatcattggaaatt
cccagatgtgacacgcctgaatggccaataaagaaaatgagaaaagaccgacttgaaaca
tctatgtcaccttctcaagagaccatgaaaactcaaatgtctgaaacccaaaaagttgag
gtaaacccttctccggtacagctgcataagcctaaaggaaatttgccatggaagagaaat
gtccacctaatttgtccagaacaccccgaggagttctacagattacctcctggaccgata
ccaggctacaatgtgacacaggctgattacgatgcagcaaaagaagcagcacagcagagg
tttcttaggctttttcaggagccatctgcaccttctgttccttcggcttctgaatcctgt
agcaaacaggtatctctaacattgcagacctccacttctcctgacaaatcttttcaagct
gtaaatgaaaaaccaaacatctctgcagcaaacactacctttacccttttctcaagctca
tctgatgcaaaatcagttaccagttccagttcaacaccctctccttttactagtgctact
acatctattaccaacaccctgcttcagtcactgggatcaggccaaacaaaatcggaatct
ccgtttccaaagaacagccttttacagattcttggcaagacagagggaaataacagccag
cctatgtttaacccagtatttggacctttagggagtgcaaatccttcccctgttactgca
gctcctggactctcaacaaccacaactgccatactcaaaccaatatgtggtgatcctcct
agccaacaagctcagacttctatgtttaaaccaatatttgagcctcccagtagccagact
gttccctctgctttatcctctccatttgtgttcagcagctccagctccactacctccaca
acatcgtttcttggtacaacaggaaatagcgtgaatacaggcaagcatgaaaaaccaaac
ttggccctaacaacctgcgccagtaacaccaccattacttccagtttagcacccacattt
ggaattacttcaaaggttgagcctgtttctcttggcggccctgcttcacaggcaaataca
tctttcagtgttattggcagtacatctgtacccgctatatcgacagcatttggatccacc
acatctgcatttactgccgcaggtcagactgcaaatccttctttttctgctaacactgct
ccaattggtgtatccagtgtctctgcaagtgaaggacagactagcatatccacaactgcc
accttctcaaaatttggagtacctgtgggacagaatgtgttttctgctagtaaccccttt
ggaagtggtacccaatctacaatgggcaccagtacacaatctgcaacaaacatcgccttc
agttttggcacttcaacatccactcagtctgcatttggtttttcacagaaccctaccatg
cttttcagcagcagcacaaaaagcaataaccctacaaacacaagtggtttcaattctatg
ggatctgtatttgggagctcaactgtcccaacttctagtattgttactccaaacaagagc
ttgtcaaccttgggaattccagaaaaatgtgaaactaaaaatcagttagtaacaaaccag
ctttcgttgggtcagggctccactccagcgccatttccatctataatgcccacacaaagc
tttgtaagctcaagtacttcgtttgcaccaagtacaccaacagtaaatcagagttccact
ccaggctcatttccatctatggcagcagtgcaaccattcacaagccccagcagtcctgct
gctggctttttttcccatggaactgcacctaaaagtagaacagcagttcgacataaactg
catccgcgtcgtccacatccacgtaagaagtaa

DBGET integrated database retrieval system