KEGG   Xenopus laevis (African clawed frog): 733235Help
Entry
733235            CDS       T01010                                 

Gene name
xiap, api3, birc4, ilp1, miha, xlp2, xxiap
Definition
X-linked inhibitor of apoptosis (EC:6.3.2.-)
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:xla04120]
Cellular Processes; Cell growth and death; Apoptosis [PATH:xla04210]
Cellular Processes; Cell communication; Focal adhesion [PATH:xla04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 412 aa AA seqDB search
MTCQCPKMSDSACDVDTDQNYFEEEVRLASFANFSSSYPVSAPALARAGFYYTGDGDRVK
CFSCMAMVEDWQHGDTAIGKHRKISPNCKFINGFNNFRSDCIQTQAPVMQNSHANGFPNS
AEDPGEKSSSEIMADYMLRTGRVVDMSKPKYPRHMAMCSEEARLQTFQNWPGYSPLMPKE
LANAGLFYTGINDQVKCFCCGGKLMNWEPSDRAWTEHQKHFPECYFVLGRDVGNVTRDAS
VQGSTYMNSYNARLETFSSWPFPIDKETLAKAGFYRIGDEDATKCFSCGGMLNCWAANDD
PWEEHAKAYPGCQFLIEEKGQQFINNAQLQRPILHKANSGEASPALPKEISIEEKLRQLE
EEKVCKVCMDRRITIVFIPCGHLVACAVCADVLDKCPICCTIIERRQKIFMS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgacatgccagtgtccaaagatgtcagacagtgcttgtgatgtggacacggaccagaat
tattttgaagaggaagtcagactggcctcctttgctaatttttcaagtagctaccctgtt
tctgccccagcactagcacgggccggcttttattacactggagatggagaccgagtaaag
tgttttagctgtatggctatggtcgaagattggcagcatggagacacggcaatcggcaag
catcggaaaatatctccaaactgtaaattcattaacggctttaataacttccgaagcgat
tgtatccaaactcaagctcctgtcatgcagaattctcatgccaatggtttcccaaattct
gctgaagacccgggtgagaaatctagttctgagattatggcagactacatgctaaggact
ggaagagttgtcgatatgtcgaaaccaaaataccccagacacatggcaatgtgtagtgag
gaagccagactgcaaacatttcaaaactggccaggctattccccgttaatgccaaaagag
cttgccaatgcaggtctcttttatacaggcatcaacgaccaagtcaaatgcttttgttgt
ggtggaaaactaatgaactgggaacctagtgacagagcttggacagaacaccaaaaacat
ttccccgaatgctactttgttttgggacgtgatgttggcaatgtgacgagagatgccagt
gtgcaaggcagtacatacatgaacagctacaatgctcgtcttgagaccttttcatcatgg
ccatttccaattgacaaggaaacactcgctaaagctggattttataggataggtgatgaa
gatgccaccaaatgcttttcttgtgggggaatgttaaattgttgggcagcaaacgacgat
ccttgggaagagcatgcaaaggcatatcctggatgccagttcctgatagaagaaaaggga
cagcaatttataaataatgcccagttacagagacctattctacacaaggcaaactctgga
gaagcatcacctgcattacccaaggagatcagcattgaagagaaactgagacaactagag
gaggagaaggtctgcaaagtttgtatggacagacggatcaccattgttttcataccctgc
ggccatcttgtggcatgtgctgtatgtgcggatgtgcttgataaatgtccaatctgttgc
actattatagaaagaagacaaaaaatttttatgtcataa

DBGET integrated database retrieval system