KEGG   Xenopus laevis (African clawed frog): 733235Help
Entry
733235            CDS       T01010                                 

Gene name
xiap.L, api3, birc4, ilp1, miha, xiap, xlp2, xxiap
Definition
(RefSeq) X-linked inhibitor of apoptosis L homeolog
  KO
K04725  
E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Ubiquitin mediated proteolysis
Apoptosis
Necroptosis
Focal adhesion
NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    733235 (xiap.L)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    733235 (xiap.L)
   04217 Necroptosis
    733235 (xiap.L)
  Cellular community - eukaryotes
   04510 Focal adhesion
    733235 (xiap.L)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    733235 (xiap.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     733235 (xiap.L)
Ubiquitin system [BR:xla04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    733235 (xiap.L)
Mitochondrial biogenesis [BR:xla03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    733235 (xiap.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
UniProt: 
Position
8L
AA seq 412 aa AA seqDB search
MTCQCPKMSDSACDVDTDQNYFEEEVRLASFANFSSSYPVSAPALARAGFYYTGDGDRVK
CFSCMAMVEDWQHGDTAIGKHRKISPNCKFINGFNNFRSDCIQTQAPVMQNSHANGFPNS
AEDPGEKSSSEIMADYMLRTGRVVDMSKPKYPRHMAMCSEEARLQTFQNWPGYSPLMPKE
LANAGLFYTGINDQVKCFCCGGKLMNWEPSDRAWTEHQKHFPECYFVLGRDVGNVTRDAS
VQGSTYMNSYNARLETFSSWPFPIDKETLAKAGFYRIGDEDATKCFSCGGMLNCWAANDD
PWEEHAKAYPGCQFLIEEKGQQFINNAQLQRPILHKANSGEASPALPKEISIEEKLRQLE
EEKVCKVCMDRRITIVFIPCGHLVACAVCADVLDKCPICCTIIERRQKIFMS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgacatgccagtgtccaaagatgtcagacagtgcttgtgatgtggacacggaccagaat
tattttgaagaggaagtcagactggcctcctttgctaatttttcaagtagctaccctgtt
tctgccccagcactagcacgggccggcttttattacactggagatggagaccgagtaaag
tgttttagctgtatggctatggtcgaagattggcagcatggagacacggcaatcggcaag
catcggaaaatatctccaaactgtaaattcattaacggctttaataacttccgaagcgat
tgtatccaaactcaagctcctgtcatgcagaattctcatgccaatggtttcccaaattct
gctgaagacccgggtgagaaatctagttctgagattatggcagactacatgctaaggact
ggaagagttgtcgatatgtcgaaaccaaaataccccagacacatggcaatgtgtagtgag
gaagccagactgcaaacatttcaaaactggccaggctattccccgttaatgccaaaagag
cttgccaatgcaggtctcttttatacaggcatcaacgaccaagtcaaatgcttttgttgt
ggtggaaaactaatgaactgggaacctagtgacagagcttggacagaacaccaaaaacat
ttccccgaatgctactttgttttgggacgtgatgttggcaatgtgacgagagatgccagt
gtgcaaggcagtacatacatgaacagctacaatgctcgtcttgagaccttttcatcatgg
ccatttccaattgacaaggaaacactcgctaaagctggattttataggataggtgatgaa
gatgccaccaaatgcttttcttgtgggggaatgttaaattgttgggcagcaaacgacgat
ccttgggaagagcatgcaaaggcatatcctggatgccagttcctgatagaagaaaaggga
cagcaatttataaataatgcccagttacagagacctattctacacaaggcaaactctgga
gaagcatcacctgcattacccaaggagatcagcattgaagagaaactgagacaactagag
gaggagaaggtctgcaaagtttgtatggacagacggatcaccattgttttcataccctgc
ggccatcttgtggcatgtgctgtatgtgcggatgtgcttgataaatgtccaatctgttgc
actattatagaaagaagacaaaaaatttttatgtcataa

DBGET integrated database retrieval system