KEGG   Xenopus laevis (African clawed frog): 733235Help
Entry
733235            CDS       T01010                                 

Gene name
xiap, api3, birc4, ilp1, miha, xlp2, xxiap
Definition
X-linked inhibitor of apoptosis (EC:6.3.2.-)
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    733235 (xiap)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    733235 (xiap)
  Cell communication
   04510 Focal adhesion
    733235 (xiap)
Mitochondrial biogenesis [BR:xla03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    733235 (xiap)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 412 aa AA seqDB search
MTCQCPKMSDSACDVDTDQNYFEEEVRLASFANFSSSYPVSAPALARAGFYYTGDGDRVK
CFSCMAMVEDWQHGDTAIGKHRKISPNCKFINGFNNFRSDCIQTQAPVMQNSHANGFPNS
AEDPGEKSSSEIMADYMLRTGRVVDMSKPKYPRHMAMCSEEARLQTFQNWPGYSPLMPKE
LANAGLFYTGINDQVKCFCCGGKLMNWEPSDRAWTEHQKHFPECYFVLGRDVGNVTRDAS
VQGSTYMNSYNARLETFSSWPFPIDKETLAKAGFYRIGDEDATKCFSCGGMLNCWAANDD
PWEEHAKAYPGCQFLIEEKGQQFINNAQLQRPILHKANSGEASPALPKEISIEEKLRQLE
EEKVCKVCMDRRITIVFIPCGHLVACAVCADVLDKCPICCTIIERRQKIFMS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgacatgccagtgtccaaagatgtcagacagtgcttgtgatgtggacacggaccagaat
tattttgaagaggaagtcagactggcctcctttgctaatttttcaagtagctaccctgtt
tctgccccagcactagcacgggccggcttttattacactggagatggagaccgagtaaag
tgttttagctgtatggctatggtcgaagattggcagcatggagacacggcaatcggcaag
catcggaaaatatctccaaactgtaaattcattaacggctttaataacttccgaagcgat
tgtatccaaactcaagctcctgtcatgcagaattctcatgccaatggtttcccaaattct
gctgaagacccgggtgagaaatctagttctgagattatggcagactacatgctaaggact
ggaagagttgtcgatatgtcgaaaccaaaataccccagacacatggcaatgtgtagtgag
gaagccagactgcaaacatttcaaaactggccaggctattccccgttaatgccaaaagag
cttgccaatgcaggtctcttttatacaggcatcaacgaccaagtcaaatgcttttgttgt
ggtggaaaactaatgaactgggaacctagtgacagagcttggacagaacaccaaaaacat
ttccccgaatgctactttgttttgggacgtgatgttggcaatgtgacgagagatgccagt
gtgcaaggcagtacatacatgaacagctacaatgctcgtcttgagaccttttcatcatgg
ccatttccaattgacaaggaaacactcgctaaagctggattttataggataggtgatgaa
gatgccaccaaatgcttttcttgtgggggaatgttaaattgttgggcagcaaacgacgat
ccttgggaagagcatgcaaaggcatatcctggatgccagttcctgatagaagaaaaggga
cagcaatttataaataatgcccagttacagagacctattctacacaaggcaaactctgga
gaagcatcacctgcattacccaaggagatcagcattgaagagaaactgagacaactagag
gaggagaaggtctgcaaagtttgtatggacagacggatcaccattgttttcataccctgc
ggccatcttgtggcatgtgctgtatgtgcggatgtgcttgataaatgtccaatctgttgc
actattatagaaagaagacaaaaaatttttatgtcataa

DBGET integrated database retrieval system