KEGG   Xenopus laevis (African clawed frog): 733431Help
Entry
733431            CDS       T01010                                 

Gene name
echs1
Definition
enoyl CoA hydratase, short chain, 1, mitochondrial (EC:4.2.1.17)
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    733431 (echs1)
   01212 Fatty acid metabolism
    733431 (echs1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    733431 (echs1)
   00650 Butanoate metabolism
    733431 (echs1)
  Lipid metabolism
   00062 Fatty acid elongation
    733431 (echs1)
   00071 Fatty acid degradation
    733431 (echs1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    733431 (echs1)
   00310 Lysine degradation
    733431 (echs1)
   00380 Tryptophan metabolism
    733431 (echs1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    733431 (echs1)
Enzymes [BR:xla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     733431 (echs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 175 aa AA seqDB search
MAMIGKAMLVPLCPIRQYLRRGYSAGPAFQYILVERKGQHHNVGLIRLNRPKALNALCDG
LMTELNQALDTFEEDPNIGAIVITGSEKAFAGLVSKVHPVDSVVDQAIICGEKISRNSKL
IVSIAKEAVSGAFELSLAEGNRLEKRLFHSTFATDDRKEGMTAFVEKRKANFTDK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgattggcaaagcaatgcttgtccctctgtgtcccatccgtcagtatcttcgt
agaggctacagtgctggcccagcttttcaatacatacttgtggagaggaaagggcaacat
cacaatgttggtctgatccgtctgaaccgaccaaaggctttgaatgcattgtgtgatgga
ttgatgacagagctcaatcaggctttggacacttttgaggaagacccaaacattggtgcc
attgttattactggtagtgaaaaggcatttgctgggcttgtgagcaaagtgcaccctgtg
gatagcgtagtagatcaggccattatctgtggggagaagatttctagaaactccaagctg
attgtgtcaatcgcaaaggaggctgtcagtggagcttttgagctgtctttggcagaaggc
aacaggctggagaaaaggctgtttcattcaacatttgctacagatgaccgtaaagaagga
atgacagcctttgtggagaaaagaaaagcaaacttcacagataaataa

DBGET integrated database retrieval system