KEGG   Xenopus laevis (African clawed frog): 733431Help
Entry
733431            CDS       T01010                                 

Gene name
echs1.L, echs1
Definition
(RefSeq) enoyl-CoA hydratase, short chain, 1, mitochondrial L homeolog
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00062  Fatty acid elongation
xla00071  Fatty acid degradation
xla00280  Valine, leucine and isoleucine degradation
xla00310  Lysine degradation
xla00380  Tryptophan metabolism
xla00410  beta-Alanine metabolism
xla00640  Propanoate metabolism
xla00650  Butanoate metabolism
xla01100  Metabolic pathways
xla01200  Carbon metabolism
xla01212  Fatty acid metabolism
Module
xla_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
xla_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
xla_M00085  Fatty acid biosynthesis, elongation, mitochondria
xla_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    733431 (echs1.L)
   00650 Butanoate metabolism
    733431 (echs1.L)
  Lipid metabolism
   00062 Fatty acid elongation
    733431 (echs1.L)
   00071 Fatty acid degradation
    733431 (echs1.L)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    733431 (echs1.L)
   00310 Lysine degradation
    733431 (echs1.L)
   00380 Tryptophan metabolism
    733431 (echs1.L)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    733431 (echs1.L)
Enzymes [BR:xla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     733431 (echs1.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 733431
NCBI-ProteinID: NP_001089131
Xenbase: XB-GENE-5945929
UniProt: Q05AV8
Position
7L
AA seq 175 aa AA seqDB search
MAMIGKAMLVPLCPIRQYLRRGYSAGPAFQYILVERKGQHHNVGLIRLNRPKALNALCDG
LMTELNQALDTFEEDPNIGAIVITGSEKAFAGLVSKVHPVDSVVDQAIICGEKISRNSKL
IVSIAKEAVSGAFELSLAEGNRLEKRLFHSTFATDDRKEGMTAFVEKRKANFTDK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgattggcaaagcaatgcttgtccctctgtgtcccatccgtcagtatcttcgt
agaggctacagtgctggcccagcttttcaatacatacttgtggagaggaaagggcaacat
cacaatgttggtctgatccgtctgaaccgaccaaaggctttgaatgcattgtgtgatgga
ttgatgacagagctcaatcaggctttggacacttttgaggaagacccaaacattggtgcc
attgttattactggtagtgaaaaggcatttgctgggcttgtgagcaaagtgcaccctgtg
gatagcgtagtagatcaggccattatctgtggggagaagatttctagaaactccaagctg
attgtgtcaatcgcaaaggaggctgtcagtggagcttttgagctgtctttggcagaaggc
aacaggctggagaaaaggctgtttcattcaacatttgctacagatgaccgtaaagaagga
atgacagcctttgtggagaaaagaaaagcaaacttcacagataaataa

DBGET integrated database retrieval system