KEGG   Xenopus laevis (African clawed frog): 734257Help
Entry
734257            CDS       T01010                                 

Gene name
agmat
Definition
agmatine ureohydrolase (agmatinase)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    734257 (agmat)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     734257 (agmat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 389 aa AA seqDB search
MAGLNAGIRFGPLFSKQLCPLRNVSQGPLRAPIIPYKQEQRSRWAPLRPYHSLPRRPPLA
LGKLQTPTNRKASGTSKFNEPPSAEFVARPAGVCTMMRLPYQETAQGLDAAFIGVPLDTG
TSNRPGARFGPRHIRGESCMIRRYNIATKAAPFESLMVADIGDVNVNLYDLKDSCRRIRE
AYQKIMATGCIPLTLGGDHTITYPILQAVAEKHGPVGLVHVDAHTDTGDTALGEKIYHGT
PFRRCVDEGLLDCKRVVQIGIRGSSYSANSYDFGRNQGFRVVLADDCWFKSLVPLMSEVR
RQMGAGPVYISFDIDGLDPSFAPGTGTPEIAGLTTSQALEIIRGCRGLSVVGCDLVEVAP
VYDQTGNTALTGANLLFEMLCVLPKVKVN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggctggactcaacgctgggatccggtttggccccctcttttctaagcagttgtgtccc
ctcaggaatgtgtcccaggggccactaagggcccccattatcccatacaagcaggagcag
agatccagatgggcccccctgagaccttatcactccttgcccaggagacccccgttagct
cttgggaaactccagactcccaccaaccgcaaggcgtccggcacctccaagtttaatgag
ccccccagtgctgagtttgtggcccgaccagcgggggtctgtaccatgatgagactcccc
taccaggagactgcacaggggttagacgctgcctttattggggtccccctggacactggc
acctcaaaccgccccggagcaaggtttgggccacgtcacattaggggggaatcttgtatg
atcaggaggtataacatcgccaccaaagctgcgccctttgaatctctcatggtggccgac
atcggggacgtcaatgtgaatttatatgacctgaaggacagctgtcggagaatccgcgag
gcctaccagaagatcatggcaaccgggtgcatccctttaaccctgggtggggatcatacc
atcacgtatcccattctgcaggcggtggctgaaaaacatgggcccgtgggactggtacac
gtggacgctcacactgatactggagacaccgccctgggggagaagatctaccatgggacc
ccattcaggcgctgcgttgatgaaggtctcctggactgtaagagggttgtacagattggg
atccggggctcctcctacagcgccaactcctatgatttcggcagaaaccaggggttccgt
gtggtcctggcagatgactgttggtttaaatctctggtcccgctgatgtcagaagtgagg
cgccaaatgggagctggacctgtttacatcagttttgacattgacggactagacccgtcc
ttcgcccctggaactggaaccccagaaatagccgggctcaccacaagccaggctctggag
atcatccgcgggtgccgggggctcagtgttgttggttgtgacctagtggaagtggctcca
gtctatgaccagactggcaacacggcactgaccggggccaacctgctcttcgagatgctc
tgcgttctgcccaaagtcaaagtcaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system