KEGG   Xenopus laevis (African clawed frog): 734259Help
Entry
734259            CDS       T01010                                 

Gene name
eif4e, eIF-4E, eif4e1
Definition
eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
RNA transport
mTOR signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:xla03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:xla04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:xla04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 213 aa AA seqDB search
MAAVEPENPNPQSTEEEKETGQEIVSPDQYIKHPLQNRWALWFFKNDKSKTWQANLRLIS
KFDTVEDFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRN
DLDRFWLETLMCLIGESFDEHSDDVCGAVVNIRAKGDKIAIWTTECDNRDAITHIGRVYK
ERLGLPAKVVIGFQSHADTATKSGSTTKNRFVV
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgtggaaccggaaaaccccaatcctcaatctacagaagaggaaaaagagact
ggtcaggagattgtaagccctgatcagtacattaagcatccactacagaacagatgggcc
ctgtggttcttcaaaaacgataaaagcaaaacttggcaggcaaatcttcgcctcatttca
aaatttgatacagttgaagatttttgggcgctttacaatcatatccaattgtctagtaat
ttaatgtcaggatgtgactactcactctttaaggatgggattgagcctatgtgggaagat
gaaaagaacaagcgtggaggtagatggctaatcacacttaacaaacaacagagaagaaat
gatttagatcgattttggctagagacgcttatgtgccttattggagagtcctttgatgaa
catagcgacgatgtctgtggagcagtagtaaatattcgagcaaaaggagacaaaatagca
atctggactactgaatgtgacaacagggatgctattacacatatagggagagtttacaaa
gaaagattaggacttcctgcaaaggtagtgattggttttcagtcccatgcagacacggct
actaagagcggctccaccactaaaaataggtttgttgtttaa

DBGET integrated database retrieval system