KEGG   Xenopus laevis (African clawed frog): 734259Help
Entry
734259            CDS       T01010                                 

Gene name
eif4e, eIF-4E, eif4e1
Definition
eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
RNA transport
mTOR signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    734259 (eif4e)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    734259 (eif4e)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    734259 (eif4e)
Messenger RNA biogenesis [BR:xla03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     734259 (eif4e)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     734259 (eif4e)
Translation factors [BR:xla03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    734259 (eif4e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 213 aa AA seqDB search
MAAVEPENPNPQSTEEEKETGQEIVSPDQYIKHPLQNRWALWFFKNDKSKTWQANLRLIS
KFDTVEDFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRN
DLDRFWLETLMCLIGESFDEHSDDVCGAVVNIRAKGDKIAIWTTECDNRDAITHIGRVYK
ERLGLPAKVVIGFQSHADTATKSGSTTKNRFVV
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgtggaaccggaaaaccccaatcctcaatctacagaagaggaaaaagagact
ggtcaggagattgtaagccctgatcagtacattaagcatccactacagaacagatgggcc
ctgtggttcttcaaaaacgataaaagcaaaacttggcaggcaaatcttcgcctcatttca
aaatttgatacagttgaagatttttgggcgctttacaatcatatccaattgtctagtaat
ttaatgtcaggatgtgactactcactctttaaggatgggattgagcctatgtgggaagat
gaaaagaacaagcgtggaggtagatggctaatcacacttaacaaacaacagagaagaaat
gatttagatcgattttggctagagacgcttatgtgccttattggagagtcctttgatgaa
catagcgacgatgtctgtggagcagtagtaaatattcgagcaaaaggagacaaaatagca
atctggactactgaatgtgacaacagggatgctattacacatatagggagagtttacaaa
gaaagattaggacttcctgcaaaggtagtgattggttttcagtcccatgcagacacggct
actaagagcggctccaccactaaaaataggtttgttgtttaa

DBGET integrated database retrieval system