KEGG   Xenopus laevis (African clawed frog): 734333Help
Entry
734333            CDS       T01010                                 

Gene name
josd2
Definition
Josephin domain containing 2
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
xla  Xenopus laevis (African clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 184 aa AA seqDB search
MSESVFHERQRLELCAVHALNNLLQKPEFSQQRAEEICRGLAPNSMINPHRSLLGTGNYD
VNVIMAALQTMDYAAVWWDKRRSLESLVPSEIFGFILNIPSPVSLGFLSLPITRKHWIAV
RQIDGVYYNLDSKLKAPIKLGGTKELKEFLHGCMSRGSCEILLVVGRDVEDARLWIRTEE
QAAT
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagtcggtgtttcacgagcggcagcggctggagctgtgcgctgtacatgctctc
aataaccttctacagaagccggagttcagccagcagagggccgaggagatctgccgcggc
ctcgctccaaactccatgattaatcctcaccgcagtcttctgggtaccggcaattacgat
gtcaacgtcattatggcagctcttcagactatggactatgcagcggtatggtgggacaaa
cgaagatctctggagagtctggttccgagtgaaatctttggcttcatcctcaatattcca
tctcctgtgtctctgggattcctctctctgcccatcacacgcaaacactggattgctgtg
cgacagattgacggtgtttactacaatttggactccaagctgaaagcacccatcaaactt
ggtggcacgaaggagttaaaggagttcctgcatggctgcatgtcgagaggctcctgtgag
atcctgttggtggttgggagggatgtggaggacgcacggctgtggataagaacagaggaa
caggcagccacataa

DBGET integrated database retrieval system