KEGG   Xenopus laevis (African clawed frog): 734333Help
Entry
734333            CDS       T01010                                 

Gene name
josd2
Definition
Josephin domain containing 2
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     734333 (josd2)
Peptidases [BR:xla01002]
 Cysteine Peptidases
  Family C86
   734333 (josd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 184 aa AA seqDB search
MSESVFHERQRLELCAVHALNNLLQKPEFSQQRAEEICRGLAPNSMINPHRSLLGTGNYD
VNVIMAALQTMDYAAVWWDKRRSLESLVPSEIFGFILNIPSPVSLGFLSLPITRKHWIAV
RQIDGVYYNLDSKLKAPIKLGGTKELKEFLHGCMSRGSCEILLVVGRDVEDARLWIRTEE
QAAT
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagtcggtgtttcacgagcggcagcggctggagctgtgcgctgtacatgctctc
aataaccttctacagaagccggagttcagccagcagagggccgaggagatctgccgcggc
ctcgctccaaactccatgattaatcctcaccgcagtcttctgggtaccggcaattacgat
gtcaacgtcattatggcagctcttcagactatggactatgcagcggtatggtgggacaaa
cgaagatctctggagagtctggttccgagtgaaatctttggcttcatcctcaatattcca
tctcctgtgtctctgggattcctctctctgcccatcacacgcaaacactggattgctgtg
cgacagattgacggtgtttactacaatttggactccaagctgaaagcacccatcaaactt
ggtggcacgaaggagttaaaggagttcctgcatggctgcatgtcgagaggctcctgtgag
atcctgttggtggttgggagggatgtggaggacgcacggctgtggataagaacagaggaa
caggcagccacataa

DBGET integrated database retrieval system