KEGG   Xenopus laevis (African clawed frog): 734353Help
Entry
734353            CDS       T01010                                 

Gene name
rnf145
Definition
RING finger protein 145
Organism
xla  Xenopus laevis (African clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 695 aa AA seqDB search
MGAKEKLEAMLNVALRVPSIMLLDVLYRWDVSSFFQQIQRSSLNKNPLFQYKYLALNMHY
VGYILSVVLLTLPRQHLAKLYLYFVAALLLFAGHQISRDYVRSELESGYEGPMHLEPLSM
NRFITALVGQLVVCTLCSCVMKTKQIWLFSAHMLPLLARLCLIPIETIVVINKFAMIFTG
LEVLYFLASNLLVPFNLAKSAYRELAQVVEVYGLLALGMSLWNQLVVPVLFMVFWLVLFA
LQIYTYFSTRDQPTSRERLLFLFLTSIAECCSTPYSLLGLVFTVSFVALGVLTLCKFYLQ
GYRAFMNDPAMNRGMTEGVTLLILAVQTGLIELQVVHRAFLLSIILFIVVASILQSMLEI
ADPIVLALGASRDKSLWKHFRAVSLCLFLLVFPSYMAYMICQFFHMDFWLLIIISSSILT
SLQVLGTLFVYVLFMIEEFRKEPVENVDDAIYYVNGTYRLLEFLVALCVVAYGVSETVFG
EWTVMGSMIIFIHSYYNVWLRAQLGWKSFLLRRDAVNKIKSLPVSTKEQLEQHNDICSIC
YQDMNSAVITPCSHFFHPGCLKKWLYVQETCPLCHCQLKSLSQQAVAESGSSTNPVVEQS
ANNPPQEPLSAVAATTETLGTVPTCSALEQEPTMDIEPAESLVERRGELEVHVSQEEANS
NSNEVLQRILTTGKVQPEDLNVKALPPESEVCAGI
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgggagcaaaggagaaattggaggccatgttaaacgtggcccttcgggtcccaagcatc
atgctgctagatgtgctatacagatgggatgtcagctcttttttccagcaaatccaaaga
agcagcctcaataaaaacccactgttccaatacaagtacctggcactcaacatgcattat
gtgggctacatcttaagcgtggtattactgactctgccccgacagcatctggctaagttg
tatctatattttgtggctgctcttttgctgtttgcagggcatcagatttccagggattat
gtccgcagtgagctcgaatctggctatgaagggccgatgcacctagaaccattgtccatg
aaccgctttattactgcactagtgggccagctggtggtgtgcactctctgctcctgtgtg
atgaagaccaagcagatctggctgttctccgctcacatgctgcctctcttggcccgcctc
tgccttatccccattgaaaccatcgttgtcattaacaagtttgccatgattttcactggg
cttgaagtcttgtactttctggcatcaaatttattagtcccctttaatcttgctaagtcg
gcataccgggagctcgcacaggtagtggaagtgtatggcctgctagccctggggatgtct
ctctggaatcagctggtggttccagtcttgttcatggtgttctggttggttttgtttgcc
cttcagatctatacctatttcagcacccgtgatcagccgacctctcgcgagcgcctcctt
ttcctctttcttacaagtatcgccgaatgctgtagcaccccgtactcactcctcggctta
gtgtttacagtctcctttgtggccctcggggtgctgaccctctgcaagttttacctgcaa
ggctaccgagctttcatgaatgacccagcaatgaacaggggcatgactgaaggagtgacg
ctgctcatcctggctgtgcagacagggctgattgaacttcaggtggtccacagggccttc
ctcctcagcatcattctcttcatcgttgtggcctccatactgcagtctatgctggaaatc
gcagatcccattgtccttgccctcggtgcttcccgtgacaagagtctgtggaaacatttc
cgtgctgtcagcctgtgtctgttcttgctggtgtttccttcttacatggcctacatgatc
tgccagttcttccacatggatttctggctcctaattatcatatcgagcagcatcctcact
tccttgcaggtcctgggaactctcttcgtctacgttttgttcatgattgaagaatttcgt
aaagaaccagtggagaacgtggacgatgcaatttattatgtcaacggtacgtatcgcctg
ctggagttcctggtggcgctgtgcgtggtggcttacggcgtctcggaaaccgttttcggg
gaatggaccgtgatgggctccatgatcatcttcatccactcctactacaacgtctggctg
cgggctcagctgggctggaagagctttcttctgcgcagggatgccgtcaacaagatcaag
tccttgcctgtttctaccaaagagcaactggagcagcacaatgacatctgctccatctgc
taccaagatatgaattcagctgtcataacaccatgcagccattttttccatcctggctgc
ctgaaaaagtggctctacgtgcaagagacttgccctctgtgtcactgtcaattaaagtct
ctgtctcaacaagcagtggccgagtctggctcctccaccaatcccgttgtggagcaaagt
gctaacaacccaccgcaggagccgttgtctgcggtagcggcaacgacagagaccttgggt
acagtgccaacatgctctgcactcgaacaagaaccaaccatggacattgagccagcagaa
tccctagtggagaggagaggggagctggaggtgcacgtttctcaagaggaagcaaactca
aatagcaatgaggtgctccaaaggatactcactacagggaaagtgcagccagaggactta
aatgtgaaggctttaccccctgaaagtgaggtctgtgcaggaatctga

DBGET integrated database retrieval system