KEGG   Xenopus laevis (African clawed frog): 734353Help
Entry
734353            CDS       T01010                                 

Gene name
rnf145.S, rnf145
Definition
(RefSeq) ring finger protein 145 S homeolog
Organism
xla  Xenopus laevis (African clawed frog)
SSDB OrthologParalogGFIT
Motif
Pfam: TRC8_N zf-RING_2 zf-C3HC4_2 zf-rbx1 zf-C3HC4_3 zf-RING_UBOX zf-C3HC4 Prok-RING_4 zf-RING_11 zf-RING_5 zf-ANAPC11
Motif
Other DBs
NCBI-GeneID: 734353
NCBI-ProteinID: NP_001089304
Xenbase: XB-GENE-17334276
UniProt: Q5BIY5
Position
3S
AA seq 695 aa AA seqDB search
MGAKEKLEAMLNVALRVPSIMLLDVLYRWDVSSFFQQIQRSSLNKNPLFQYKYLALNMHY
VGYILSVVLLTLPRQHLAKLYLYFVAALLLFAGHQISRDYVRSELESGYEGPMHLEPLSM
NRFITALVGQLVVCTLCSCVMKTKQIWLFSAHMLPLLARLCLIPIETIVVINKFAMIFTG
LEVLYFLASNLLVPFNLAKSAYRELAQVVEVYGLLALGMSLWNQLVVPVLFMVFWLVLFA
LQIYTYFSTRDQPTSRERLLFLFLTSIAECCSTPYSLLGLVFTVSFVALGVLTLCKFYLQ
GYRAFMNDPAMNRGMTEGVTLLILAVQTGLIELQVVHRAFLLSIILFIVVASILQSMLEI
ADPIVLALGASRDKSLWKHFRAVSLCLFLLVFPSYMAYMICQFFHMDFWLLIIISSSILT
SLQVLGTLFVYVLFMIEEFRKEPVENVDDAIYYVNGTYRLLEFLVALCVVAYGVSETVFG
EWTVMGSMIIFIHSYYNVWLRAQLGWKSFLLRRDAVNKIKSLPVSTKEQLEQHNDICSIC
YQDMNSAVITPCSHFFHPGCLKKWLYVQETCPLCHCQLKSLSQQAVAESGSSTNPVVEQS
ANNPPQEPLSAVAATTETLGTVPTCSALEQEPTMDIEPAESLVERRGELEVHVSQEEANS
NSNEVLQRILTTGKVQPEDLNVKALPPESEVCAGI
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgggagcaaaggagaaattggaggccatgttaaacgtggcccttcgggtcccaagcatc
atgctgctagatgtgctatacagatgggatgtcagctcttttttccagcaaatccaaaga
agcagcctcaataaaaacccactgttccaatacaagtacctggcactcaacatgcattat
gtgggctacatcttaagcgtggtattactgactctgccccgacagcatctggctaagttg
tatctatattttgtggctgctcttttgctgtttgcagggcatcagatttccagggattat
gtccgcagtgagctcgaatctggctatgaagggccgatgcacctagaaccattgtccatg
aaccgctttattactgcactagtgggccagctggtggtgtgcactctctgctcctgtgtg
atgaagaccaagcagatctggctgttctccgctcacatgctgcctctcttggcccgcctc
tgccttatccccattgaaaccatcgttgtcattaacaagtttgccatgattttcactggg
cttgaagtcttgtactttctggcatcaaatttattagtcccctttaatcttgctaagtcg
gcataccgggagctcgcacaggtagtggaagtgtatggcctgctagccctggggatgtct
ctctggaatcagctggtggttccagtcttgttcatggtgttctggttggttttgtttgcc
cttcagatctatacctatttcagcacccgtgatcagccgacctctcgcgagcgcctcctt
ttcctctttcttacaagtatcgccgaatgctgtagcaccccgtactcactcctcggctta
gtgtttacagtctcctttgtggccctcggggtgctgaccctctgcaagttttacctgcaa
ggctaccgagctttcatgaatgacccagcaatgaacaggggcatgactgaaggagtgacg
ctgctcatcctggctgtgcagacagggctgattgaacttcaggtggtccacagggccttc
ctcctcagcatcattctcttcatcgttgtggcctccatactgcagtctatgctggaaatc
gcagatcccattgtccttgccctcggtgcttcccgtgacaagagtctgtggaaacatttc
cgtgctgtcagcctgtgtctgttcttgctggtgtttccttcttacatggcctacatgatc
tgccagttcttccacatggatttctggctcctaattatcatatcgagcagcatcctcact
tccttgcaggtcctgggaactctcttcgtctacgttttgttcatgattgaagaatttcgt
aaagaaccagtggagaacgtggacgatgcaatttattatgtcaacggtacgtatcgcctg
ctggagttcctggtggcgctgtgcgtggtggcttacggcgtctcggaaaccgttttcggg
gaatggaccgtgatgggctccatgatcatcttcatccactcctactacaacgtctggctg
cgggctcagctgggctggaagagctttcttctgcgcagggatgccgtcaacaagatcaag
tccttgcctgtttctaccaaagagcaactggagcagcacaatgacatctgctccatctgc
taccaagatatgaattcagctgtcataacaccatgcagccattttttccatcctggctgc
ctgaaaaagtggctctacgtgcaagagacttgccctctgtgtcactgtcaattaaagtct
ctgtctcaacaagcagtggccgagtctggctcctccaccaatcccgttgtggagcaaagt
gctaacaacccaccgcaggagccgttgtctgcggtagcggcaacgacagagaccttgggt
acagtgccaacatgctctgcactcgaacaagaaccaaccatggacattgagccagcagaa
tccctagtggagaggagaggggagctggaggtgcacgtttctcaagaggaagcaaactca
aatagcaatgaggtgctccaaaggatactcactacagggaaagtgcagccagaggactta
aatgtgaaggctttaccccctgaaagtgaggtctgtgcaggaatctga

DBGET integrated database retrieval system