KEGG   Xenopus laevis (African clawed frog): 734368Help
Entry
734368            CDS       T01010                                 

Gene name
tmx3-b, pdia13, txndc10, txndc10b
Definition
thioredoxin-related transmembrane protein 3 (EC:5.3.4.1)
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     734368 (tmx3-b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 452 aa AA seqDB search
MAAAGFCFILATVTSTSLLASVPVSAFVEDLDDSFKENRKDDIWLVDFYAPWCGHCKKLE
PVWNDVGIEIRSSGSPIRVGKMDATVHSSIASEFGVRGFPTIKVLKGDMAYNYRGPRTKE
DIVEFANRVAGPVIRPLPSQQMFDHVQKRHPVLFVYVGVDSTLKEKFIEVASELIVYTYF
FSASEDVLPKYVTLNEVPAVLVFKDSTYFVYDEYEDGDLSSWVNKERFEGYLHIDGFTLY
ELGDTGKLVAVAVIDEKNNSIEHTRLKSVAQDVAKNYRDHVHRDFQFGHMDGNDYINSLL
MDELSIPTFVVLNTSNQQYFLPSKQIENTEEMIQFINSILDGTAEAQGGDGILQRIKRVF
YDAKSTVVSVFKSSPLLGCFLFGLPLGVISIMCYGICTADTEDGSEEMTRKDVIDQNGSD
EGSDEEEEKSREITDMSDEDQQEKDFMEKKID
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgccggattctgtttcattttagctacagtcacttcaacttccctattggct
tctgtccctgtgtctgcatttgtagaagatttggatgactcatttaaagaaaacagaaag
gatgatatctggcttgttgatttttatgcaccttggtgtggtcattgtaagaagcttgaa
cccgtctggaatgacgttggtattgaaataaggagtagcggctcacccattcgagttgga
aaaatggatgctacggttcactcaagtattgcttcagaatttggagtcagaggatttcca
acaataaaggtgttgaaaggggatatggcttataactacagaggtccaagaacaaaggag
gatatagttgagtttgcaaacagagttgctgggccagtaatccgtccacttcccagccaa
cagatgtttgatcatgttcaaaaacgtcatccagtactttttgtatatgttggtgtagac
tcaacgctaaaggaaaaattcattgaagttgcttcagaactcattgtgtacacatacttc
ttctcagcatcagaggatgttttgcctaagtatgttacactaaatgaggtcccggcagtt
cttgtttttaaagactccacatattttgtttatgatgaatatgaagatggagatttatca
agttgggtgaataaggagagatttgaaggatatcttcatatagatggatttacattgtat
gaactcggtgatacaggaaaactggtggctgttgcagttatagatgaaaagaacaattcc
attgaacatacaagattgaaatcagttgctcaagatgtagcaaaaaactacagggatcat
gttcatagagacttccagtttgggcacatggacgggaatgactacataaacagtttatta
atggatgaactcagtatccccacttttgttgttcttaacacatcaaatcagcaatatttt
ctgccaagcaagcaaattgaaaacactgaagaaatgattcagtttattaatagtattctg
gatggtacagctgaggctcaaggaggcgatgggatattgcagagaatcaagagggttttt
tatgatgccaagtccacagtggtttcagtcttcaagagttcacccctgcttggctgcttt
ctctttggtctgccactgggtgtcatcagtataatgtgttacggaatctgtacagccgac
actgaagatggttcggaagaaatgaccagaaaggatgtaatagatcagaatggatccgac
gagggcagcgacgaagaggaagagaagagcagagagattacagacatgtcggatgaagat
caacaagaaaaggattttatggaaaagaaaatagattaa

DBGET integrated database retrieval system