KEGG   Xenopus laevis (African clawed frog): 734402Help
Entry
734402            CDS       T01010                                 

Gene name
hdac10
Definition
histone deacetylase 10 (EC:3.5.1.98)
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     734402 (hdac10)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     734402 (hdac10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 683 aa AA seqDB search
MACGTALVYDEEMMSYKLLWDDPECSIEVPERLSSSYKRLQDYDLVKRCIQLPVREATDE
EITLVHSHDYLQVVKSTQTMNEKELKEISQKYTAVFYHQNSFRCAKLSLGGTLQLVDAIL
TREVQNGMAIVRPPGHHSQRNQGNGFCVFNNVAIAAEYAKKKYKLERILIVDWDVHHGQG
IQYIFEEDPSVLYFSWHRYEHKTFWPYLRESDYDVIGRGKGTGFNINLPWNKVGMGNADY
IAAFFHVLLPLAFEFNPELVLVSAGYDSAIGDPEGRMCATPECFSHLTNMLMNLAGGKLC
AVLEGGYNLRSLAESVCMTVRTLLGDPLPRLTGEMTPCHSALESIQNVRAAHTPYWKCLL
YNEIKSAHDPSSEGDSQHSSDQQQNFDTAMFDIFLDSHMKKIEFAVPPLRTCAVLPEGCC
LALPDGVLVEEKTATREHIIACSSSLPNELLEKETMLATLGKMLVILNKLLEYQTMNSIV
LSPDSSVCATFAIKHVLASPVKRLLCINIGDLGILHEFDNDGEYVCLNICGTYPTGMSNR
QIYLKWTESPNEYSSFFYIIFCCILPLAYNYQPDFIIITTGSNRTIGDKDISLLISLLQG
LANGRILTIIPETEPKLGQKLVKCLSDSPGEKHFGPHRAPSLENIQNLKEKLDIIEKEWK
MLQCSAKAAGTIPGSTHQCETRD
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggcttgtggtactgcattagtttatgatgaagaaatgatgagctataagctgttatgg
gatgacccagaatgttctattgaagttcctgagaggttatcttcctcctataagaggcta
caggattatgatctagtgaagcgatgcatccagttacctgtgagagaggctacagatgaa
gagatcactttggtacacagccatgactatctacaggttgtcaaaagcacccagactatg
aatgaaaaggagcttaaagaaatctcacagaaatatacagctgtattttaccatcagaat
tcttttcgctgtgccaagctgtcacttggtggcacactacagctggtggatgccatattg
acacgagaagtccaaaatggaatggcgattgtaaggccccctggacatcacagtcagcgc
aatcaaggcaatggattctgtgttttcaataatgttgcaatagcagcagaatatgctaag
aagaaatacaaattagagagaatattgattgttgattgggatgttcaccatgggcaagga
attcagtacatctttgaggaggacccaagtgttctatatttttcatggcatcgttatgag
cacaaaacattttggccatacctcagagagtctgactatgatgtgatcggcagagggaaa
ggcacaggctttaacataaatctgccatggaacaaggttggcatggggaatgctgattac
attgctgcttttttccatgttctccttcctttggcctttgagtttaatccagagctggtt
cttgtttctgctggatatgactcggcaattggagatccagaaggcaggatgtgtgcaact
cctgagtgcttctcacatcttacaaatatgcttatgaaccttgctggaggcaaactttgt
gcagttctggagggtggatacaatctccggtcattagcagaatccgtctgcatgactgta
agaacattacttggggaccctttacccagactgactggagaaatgacaccatgccacagt
gctttggagtccatacaaaatgtaagagctgcacatactccatattggaagtgtttgtta
tataatgaaataaaatcagcacatgacccaagttctgaaggagactctcaacactccagt
gaccagcaacaaaactttgatacagcaatgtttgatatttttttggattcccatatgaag
aaaattgaatttgctgtacctcctttaagaacatgtgctgtgcttcctgagggctgctgt
cttgctttgcctgatggagtgctagtggaagagaaaaccgctactagggaacatattatt
gcttgtagcagctctttgcctaatgaactattggaaaaagaaacaatgttagctactttg
ggaaagatgcttgttattctcaataaacttttagagtatcagacaatgaattccattgta
ttatcacctgattcttctgtctgtgctacttttgccatcaagcatgtattagcttctcca
gtaaaaaggttgctttgtatcaatattggagatttgggaattcttcatgaatttgataat
gatggggaatatgtttgtctgaatatctgtggaacttaccctacaggcatgagtaacaga
caaatctatctgaagtggactgaaagtcctaatgaatacagcagcttcttctatattata
ttctgctgtatacttccactggcctacaactaccagcctgactttattataatcactaca
ggaagtaatagaactattggggataaggacatttctcttctcattagtctgttgcagggc
ctggctaatggcagaattcttactatcattccggaaaccgaaccaaagctgggtcaaaag
ctggtcaaatgcttgtcagactctcctggagaaaagcactttgggccacatagagcacca
tcactagaaaatattcagaacctgaaagaaaaacttgatattattgaaaaggaatggaaa
atgcttcagtgtagtgctaaagcagcagggaccataccaggcagcacacatcaatgtgag
actagagactaa

DBGET integrated database retrieval system