KEGG   Xenopus laevis (African clawed frog): 734415Help
Entry
734415            CDS       T01010                                 

Gene name
pla2g15, lypla3
Definition
phospholipase A2, group XV
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    734415 (pla2g15)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    734415 (pla2g15)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     734415 (pla2g15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 422 aa AA seqDB search
MDEVSCVCIRIKSFYYARLLFLLFCVTGCFSFLNYRPSCGVGGCSPGPPVVLVPGDLGNQ
LEAKLDKPSVVHYMCSKKTNDYFTLWLDLELLLPIIIDCWIDNIRLVYNKTSKTTAPPEG
VDIRVPGFGQTYSLEFLDPSKRSVGSYFYTLVQSLVAWGYTRDENVRGVPYDWRKAPNEN
SEYFVAVRKLVESMFESYQSPVVLVAHSMGNLYTLYFLNQQTQDWKDKYIHSFVALGAPW
GGVSKTLRVLASGDNNRIPVISSLKLRDQQRSAVSTNWLLPYNNTWPQKKVFVRTPQKNY
TIKDYKMFYEDIGFQDGWEMRKETEGLVSSLNPPGVDVHCLYGTGVDTPDSFSYDSFPDK
EPTTVYGAGDGTVNLESALQCGKWRNRQRQKVSLVELPGNEHIAMLSNISTISYVKKILF
GL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggacgaagtatcatgtgtttgcattaggatcaaaagcttctactatgctcgtcttttg
tttctgctgttctgtgtcactggctgcttctccttcctcaactatcggccgtcctgtgga
gttggcggctgttccccagggccacctgtggtgctcgtgccaggggacttgggaaaccag
ctggaggcgaaattagataaaccgtcagttgtgcattatatgtgctctaaaaagacaaat
gattacttcactctgtggctggatttggaactgctgctgcctataattattgactgctgg
attgataacatcaggttggtttacaataaaacaagcaaaactactgccccaccagaggga
gttgatatcagagttcctggttttgggcagacttattccctggaattcttggatccaagt
aaaaggagtgtaggttcatatttttacacacttgtgcagagcctggtagcttggggatat
acccgtgatgaaaatgtgagaggagtaccttatgactggcgcaaagctcctaatgaaaat
tctgaatattttgtggctgttcgcaagctagtggagtctatgtttgagtcatatcaaagt
cctgtagttcttgttgctcacagcatgggaaatctgtacaccctttacttcctcaaccag
caaacacaggattggaaggataaatatatacattcctttgtggctctaggtgctccatgg
ggtggtgtgtctaagactctgcgtgtcctggcttcaggagataataatcgcattccagtg
attagctccctaaaacttcgcgaccagcagcggtcagctgtttccacaaattggctactc
ccttataacaacacttggccacagaaaaaggtttttgtaagaaccccccaaaaaaactac
acaataaaggactacaagatgttctacgaggacattggattccaagatggatgggaaatg
aggaaagaaacagaaggacttgtatcttcactaaatcctcctggagtggatgtacactgt
ctttatgggactggagtggacacccctgattcgttctcatacgattctttcccagataaa
gaacccactacagtttatggggcaggggacgggacagttaatttggaaagcgctttacaa
tgtggaaagtggcggaatcggcagagacagaaagtgtcattggttgagctacctggaaat
gaacacattgctatgctgtccaacatttcaaccatctcgtatgtaaagaagattttgttt
ggattgtag

DBGET integrated database retrieval system