KEGG   Xenopus laevis (African clawed frog): 734438Help
Entry
734438            CDS       T01010                                 

Gene name
bap1, hucep-13, hucep-6, uchl2
Definition
BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) (EC:3.4.19.12)
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     734438 (bap1)
Peptidases [BR:xla01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   734438 (bap1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 618 aa AA seqDB search
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCPGPVYGFIFLFKWIEERRSRR
KVSTLLDDTSVMEDEVVNNMFFAHQLIPNSCATHALLSVLLNCGGVHLGPTLSRIKEFTK
GFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKGRL
FELDGLKVYPIDHGPWAEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRLK
YEGKLNILKMNRQTVLEALQQLIRVTQPELIQAQKSTDGQSTEETKSPAIKAPVSQESHR
AHHGSHRSTTDLGAEPAGSLLRGPVLSAHNKSKPLPQNGGIVPAPASRLPAFLDNHNYAK
SPMQEEEDLAAGVGRSRGVPPPAPDTDEEEEEETENVRRPLTPPGFKRRSSESLPPPPGP
EPGVLAEKLKETQRDLCSPLSIKTGAPTAPHSQPSPTPSNESTDTASEIGSAFNSPLRSP
LRSANPTRPSSPVTSHLSKVLFGEEEPLSRLDCVRYNRAVRELGPHISTGILHLSKDGYL
SPLSRLDTGKVSPKSHKAEEPRESPEPDSERNRVTEAPQGEKFSPKELLALLKCVEAEIS
ASEACLREELEKRKKIQD
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaggctggttagagctggaaagcgatccaggactttttacactgctggttgaa
gattttggagtgaaaggggtgcaggtggaggagatctatgaccttcagagcaagtgccca
gggccagtgtatggctttatcttcctattcaaatggatcgaggagcggcgatcgcgcagg
aaagtctccactctgctggatgacacgtccgttatggaagatgaggttgtcaacaacatg
ttctttgcccatcagctgatccctaattcatgtgctactcacgcactcctgagtgtctta
ctgaactgtggtggggttcatctggggcccacactgagccggatcaaggaattcaccaaa
ggattcagcccagagagtaaaggttatgcgattgggaatgctccagaactggcaaaagct
cacaacagccatgccagaccagagccccgccacctgcctgagaagcagaatgggatcagt
gctgttcggaccatggaagcttttcactttgtcagttatgttcctattaaaggacgactt
tttgaacttgatgggttgaaagtctaccctattgaccatggtccctgggcagaggatgaa
gaatggacagacaaggctcgcagagtgatcatggagaggatcgggctggctacagcaggg
gagccgtatcatgacattaggtttaacctgatggcagtggtgcctgatcgaaggcttaaa
tatgagggcaaacttaacattttaaagatgaacagacagactgtgctggaggcattgcaa
cagttgataagagtaactcagccggaactgattcaggctcagaagtctacagatggccag
agcacagaagaaacaaagagtcctgcaataaaggctccagtgtcccaggagagccatcgg
gcccaccatggatcccacaggagcaccacagacttgggtgcagaaccagcagggtccctc
ctccgaggccctgttctgtctgctcataataaatccaaacccctaccccagaacggaggt
attgtacctgcaccagcttcacgactgccggccttccttgacaaccataactatgccaag
tcacctatgcaggaagaggaggacttggctgcaggggtgggcagatcgcgcggtgtccct
ccacctgctccagacacagatgaagaggaagaagaggaaactgaaaatgttagaagaccc
ctgacacctccggggttcaagagaaggagttcagagtctttgcctccacccccaggacct
gaacctggtgttttagcagagaaactaaaagagacacagagggatttgtgctcccccctt
tccataaaaacaggagctcctactgctccccactctcagccttcccctaccccaagcaac
gagagcacagacactgcctcggaaattggtagtgcgtttaactccccacttcgttctcct
ctaagatctgccaacccgacccgtccctccagtcctgtcacctctcatttgtccaaagtt
ctctttggtgaggaggaaccactgtcacgtctagactgtgtgcgctataatagagcagtg
cgggaactgggaccacatatcagcactgggattctgcatttgagcaaggatggatacctg
tccccacttagcaggctagacacaggtaaagtatcacccaagagtcacaaagcagaggag
ccaagagagagtccagagccagactccgagcgcaacagagtcacagaagctccccaaggg
gaaaaattttctcctaaggagctgctagctttgctgaagtgtgtcgaagctgaaatctct
gcatcagaagcctgtctgcgggaggaactagaaaaacgcaaaaaaattcaagattga

DBGET integrated database retrieval system