KEGG   Xenopus laevis (African clawed frog): 734447Help
Entry
734447            CDS       T01010                                 

Gene name
usp12-a, ubh1, usp12, usp12l1
Definition
ubiquitin specific peptidase 12 (EC:3.4.19.12)
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
xla  Xenopus laevis (African clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 370 aa AA seqDB search
MEILMTVSRIASICTMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFC
RPFREKVLAYKSQPRKKENLLTCLSDLFHSIATQKKKVGVIPPKKFITRLRKENELFDNY
MQQDAHEFLNYLLNTIADILQEERKQEKQNGRIPNGNIDNENNNSAPDPTWVHEIFQGTL
TNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQ
EAHKRMKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMY
DLVAVVVHCGSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSES
GYILFYQSRD
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcctaatgacagtctccaggatcgcttctatctgtaccatgggcgccaatgcc
tcagctttagagaaagagattgggccggaacagtttccagtaaatgagcactatttcgga
ttagtaaattttgggaacacctgctactgcaattccgttcttcaagcactttatttctgt
cggccgtttcgggagaaagtccttgcttacaaaagccagcctaggaagaaagagaatctt
ctcacttgcttgtcagatctgttccacagtattgccacccagaagaaaaaggttggagta
atccctcccaagaaatttatcaccaggctacggaaagaaaatgagctatttgacaactac
atgcaacaggacgctcatgaattcctgaactatctactaaacacaatagccgacattttg
caagaggagcgcaagcaagagaaacagaatggaaggatccctaatggtaacattgacaac
gaaaacaacaatagtgcacctgatcccacctgggtccacgagatctttcagggaactctg
acgaacgaaacccggtgtcttacgtgtgaaacgataagcagcaaagatgaggatttttta
gatctttctgtggatgtggagcagaacacatcaatcactcattgtttaaggggttttagt
aatacagaaacactttgtagtgaatataaatattactgtgaagagtgtcgcagtaagcag
gaagcacacaaaaggatgaaggttaaaaagctgcctatgattttagccctccacctaaaa
aggttcaagtacatggatcaactacatcgatatacaaagctctcctacagagtagtcttt
cctttagaacttcggctgtttaacacatcaggagatgccaccaacccagacagaatgtat
gaccttgtggctgtggtcgtgcactgcggaagtggtccaaatagaggacattatattgca
atagtgaagagtcatgacttttggctgctgttcgatgatgatattgtagagaaaatagat
gcacaagctatagaggaattctacgggttgacatctgatatctcaaagaactccgaatcg
ggatacattcttttctaccagtctcgagactga

DBGET integrated database retrieval system