KEGG   Xenopus laevis (African clawed frog): 734447Help
Entry
734447            CDS       T01010                                 

Gene name
usp12-a, ubh1, usp12, usp12l1
Definition
ubiquitin specific peptidase 12 (EC:3.4.19.12)
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     734447 (usp12-a)
Peptidases [BR:xla01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   734447 (usp12-a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 370 aa AA seqDB search
MEILMTVSRIASICTMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFC
RPFREKVLAYKSQPRKKENLLTCLSDLFHSIATQKKKVGVIPPKKFITRLRKENELFDNY
MQQDAHEFLNYLLNTIADILQEERKQEKQNGRIPNGNIDNENNNSAPDPTWVHEIFQGTL
TNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQ
EAHKRMKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMY
DLVAVVVHCGSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSES
GYILFYQSRD
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcctaatgacagtctccaggatcgcttctatctgtaccatgggcgccaatgcc
tcagctttagagaaagagattgggccggaacagtttccagtaaatgagcactatttcgga
ttagtaaattttgggaacacctgctactgcaattccgttcttcaagcactttatttctgt
cggccgtttcgggagaaagtccttgcttacaaaagccagcctaggaagaaagagaatctt
ctcacttgcttgtcagatctgttccacagtattgccacccagaagaaaaaggttggagta
atccctcccaagaaatttatcaccaggctacggaaagaaaatgagctatttgacaactac
atgcaacaggacgctcatgaattcctgaactatctactaaacacaatagccgacattttg
caagaggagcgcaagcaagagaaacagaatggaaggatccctaatggtaacattgacaac
gaaaacaacaatagtgcacctgatcccacctgggtccacgagatctttcagggaactctg
acgaacgaaacccggtgtcttacgtgtgaaacgataagcagcaaagatgaggatttttta
gatctttctgtggatgtggagcagaacacatcaatcactcattgtttaaggggttttagt
aatacagaaacactttgtagtgaatataaatattactgtgaagagtgtcgcagtaagcag
gaagcacacaaaaggatgaaggttaaaaagctgcctatgattttagccctccacctaaaa
aggttcaagtacatggatcaactacatcgatatacaaagctctcctacagagtagtcttt
cctttagaacttcggctgtttaacacatcaggagatgccaccaacccagacagaatgtat
gaccttgtggctgtggtcgtgcactgcggaagtggtccaaatagaggacattatattgca
atagtgaagagtcatgacttttggctgctgttcgatgatgatattgtagagaaaatagat
gcacaagctatagaggaattctacgggttgacatctgatatctcaaagaactccgaatcg
ggatacattcttttctaccagtctcgagactga

DBGET integrated database retrieval system