KEGG   Xenopus laevis (African clawed frog): 734485Help
Entry
734485            CDS       T01010                                 

Gene name
mapk15
Definition
mitogen-activated protein kinase 15 (EC:2.7.11.24)
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
xla  Xenopus laevis (African clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 586 aa AA seqDB search
MSGPEVEDHISQKYDIKKRLGKGAYGIVWKAIDRKSGEIVAVKKIFDAFRNRTDAQRTFR
EIMFLQEFGEHPNIIKLLNVIRAQNDKDIYLVFEHMETDLHAVIKKGNLLKDIHMRYILY
QLLKATKFIHSGNVIHRDQKPSNILLDGDCLVKLCDFGLARSLYQIQEDVGNPALTEYVA
TRWYRAPEILLASNRYTKGVDMWSVGCILGEMLLGKPLFPGTSTINQIERIMSIIEPPTH
EDIVSIKSEYGASVISRMSSKHKVPMAELFPASCPREALDLLSKLLVFNPGKRLTAEEAL
EHPYVSRFHSPAREPALDYDVILPVDDDIQLSVAEYRNKLYEMILERKMNIRRQKRESLK
ESVSSSANGAKDRQDTDTSKTPAPPAGTNPAPQPTSSTVPQRAAIAAPNQPPAQKDSTQQ
SPKIKAPSSNPITHSTTHGSTEDWRTSHNKKAGQQGAAGTTAQEVRKEVESRSRTAPIGR
ARSFSHSQQARAAATNSALIRKDAPPTGTVSVAAVSARLNQRTAPIQGRDPRSAPRFGRK
MFQGKTNVESAGDPKATLHSYTQAYGTISKAALQNLPQQGGAFKGK
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcccagaggtggaagatcacatctcgcagaaatatgacatcaaaaagcgactt
gggaagggggcctatggaattgtctggaaagccattgatcgcaaatctggagaaattgtt
gctgtgaaaaaaatctttgatgccttcaggaatcgcacagacgctcagaggacttttcgt
gaaatcatgttcctgcaggagtttggggagcatccaaacatcatcaagttgctgaatgtg
attcgagctcagaatgataaggatatttacctggtgtttgagcacatggagacagatcta
catgctgtgataaagaaggggaatctactgaaagacattcatatgagatatatcctctac
cagctgctcaaggccaccaagtttatccactctggcaatgtcattcacagagaccaaaag
ccctctaacatcctactagatggagactgtctggtgaaactgtgtgactttggcctggcc
cgttccctctatcagatccaggaggatgtggggaacccggcactgacagaatatgttgct
acgcgctggtatagagctccagagatcttgctggcttccaacagatataccaagggtgtg
gatatgtggagtgtgggctgcattctgggggagatgttgcttgggaaacccctctttcca
gggacatctaccatcaaccagattgagaggattatgagcatcattgagccccctacacat
gaagatatcgtgtctataaaatcggagtatggagcctcagtaatcagcaggatgagttct
aagcataaggtgcccatggcagagctgtttcctgcgagttgccccagggaagccctcgac
ctactgagtaaacttctggtcttcaatccggggaagagactcacggcagaagaggctctg
gaacatccatatgtcagcagattccactctccggcccgggaacctgcattggattatgat
gtcatcctcccagtggatgacgacatccagttgtctgtggctgaatatcgtaacaaactg
tatgagatgattcttgagaggaaaatgaatattcgaagacagaaacgtgaatccctgaag
gaaagtgtaagctcttccgctaatggtgcaaaagacagacaggatacagatacttctaag
actccagcacccccagcgggaacaaaccctgcaccccaacccacttcctccactgttccc
caaagagctgctattgctgcacccaaccaaccccctgcacaaaaggacagcacccaacag
agccccaaaatcaaagcaccttcttctaaccccataactcacagcacaacccacggcagc
acggaggactggcggacatcacacaacaagaaggcaggccagcagggggcagcagggacc
acagcacaagaggtccggaaggaggtggagtcccgaagcagaactgctcccattggtcga
gctcgttctttctctcacagccaacaggctcgcgcagcagcaactaacagcgccctcata
cggaaggatgccccccccacgggcacagtgagtgtggctgcagttagtgccagactgaac
cagcgcacggctccaatacaaggacgagatccgcgttctgctcccagatttggcaggaag
atgtttcaggggaaaacaaatgtggaatcagccggggaccccaaagccactttgcacagt
tacacacaggcctacggcaccattagtaaagccgccttgcagaacctgccccaacaggga
ggcgccttcaaggggaaataa

DBGET integrated database retrieval system