KEGG   Xenopus laevis (African clawed frog): 734669Help
Entry
734669            CDS       T01010                                 

Definition
uncharacterized protein MGC116437
Orthology
K03259  
translation initiation factor 4E
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
RNA transport
mTOR signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:xla03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:xla04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:xla04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 235 aa AA seqDB search
MNNKFDALKDDDSGDHDQNEENGTQKDSEKEKNDDKEKNQGSSRKKSVVPGPAEHPLQYN
YTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEG
IKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDI
ISIWNKTASDQATTARIRDTLRRVLNLPPNTVMEYKTHTDSIKDKTSFRNTKIAL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaaattcgatgctcttaaagatgatgacagtggggatcatgatcagaacgaa
gaaaacggcacacagaaagacagtgagaaggaaaaaaatgacgacaaggagaaaaaccaa
ggctcttctaggaaaaagagtgttgtgccaggtccagccgagcaccccttacagtacaac
tacacattctggtactcgcgcagaactccgggaaggccaaccagctcccagagctatgag
cagaacattaaacagatcggtaccttcgcttctgtggaacaattttggaggttctatagt
cacatggtacgacctggggacctgactgggcacagtgattttcacctcttcaaggaaggg
atcaaaccaatgtgggaggatgatgcaaacaaaaatggaggaaagtggataattcgcctt
cgcaaaggtctagcatcacgatgctgggagaatctcatactggccatgttgggagagcag
ttcatggttggagaggagatctgtggagctgttgtctctgttcgtttccaggaagacatc
atatccatttggaacaagactgcaagtgatcaggcaaccactgctcgtatccgagacaca
ttgcgccgagtcctgaatttgcctcccaacactgttatggaatacaaaacgcacacagac
agcatcaaggacaaaacaagcttcagaaataccaaaattgctttgtga

DBGET integrated database retrieval system