KEGG   Xenopus laevis (African clawed frog): 734739Help
Entry
734739            CDS       T01010                                 

Gene name
mrps18b, mrp-s18-2, mrps18-2, ptd017, s18amt
Definition
mitochondrial ribosomal protein S18B
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Ribosome [BR:xla03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    734739 (mrps18b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 222 aa AA seqDB search
MATWLGGVCVSAIKRALWCKVPGPTLFLCSRQLASLADSFDANSRYKDQPWEYLNSEEYL
QRYGQKSIWADYRRNHKGPIPPQKTRKTCIRGGKVCGNPCPICRDEKLGLHYKNVKLLQQ
FICPHTGIVYDPTTTGVCMKQQKVLMKVITEATDHGFLPAHVPYIVLPHEDYLNSHGAVS
DTLSPKAGPWYSWYEWQEPNPKDAVRLRKLYKPYLKEMMANK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggctacttggttgggtggcgtgtgtgtgtctgccatcaagcgggcgctttggtgcaag
gttcctggtcccactttgtttttgtgcagtcgccaacttgcaagtcttgctgactccttt
gatgcaaattctcgctataaagaccagccttgggagtatttgaatagtgaagaatattta
cagaggtatggccagaaatctatatgggctgattacagacgaaaccataaagggcctatt
ccaccacaaaagacccgtaaaacctgtattagaggagggaaggtttgtgggaatccatgc
ccaatctgtcgggatgagaagctcggcttgcattataagaatgtgaaattacttcagcag
tttatatgtccccatacaggaatagtttacgatccaacaacaacaggtgtgtgtatgaaa
cagcagaaagtcttgatgaaagttattacagaggcaacggatcatgggtttcttcctgct
catgttccctatatagttttgcctcatgaagactatttaaatagccatggtgccgtttca
gacacactttcgcctaaagcaggaccttggtactcctggtatgagtggcaggagccaaac
cccaaagatgcagtacgactgagaaagctttataaaccctacctgaaagagatgatggcc
aataaataa

DBGET integrated database retrieval system