KEGG   Xenopus laevis (African clawed frog): 734775Help
Entry
734775            CDS       T01010                                 

Gene name
ccna2.L, ccna2
Definition
(RefSeq) cyclin A2 L homeolog
  KO
K06627  
cyclin A
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Progesterone-mediated oocyte maturation
Module
Cell cycle - G2/M transition
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    734775 (ccna2.L)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    734775 (ccna2.L)
DNA replication proteins [BR:xla03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    734775 (ccna2.L)
Chromosome [BR:xla03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    734775 (ccna2.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 415 aa AA seqDB search
MADPLLRDENQENVQPRKPLAPVGGRTVLGVLQENHRGRQALKTGKPALQQTQVLSVNHL
GVNDENYGKIPAGKAANKQPTFTIHVDEPDCANNRRKPVHKKTVQDENLRQLNTVLGTIG
TRKPLEPIQIAMETSFGSPMDMSIVDEEQKVVACSNVLDYAKEIHTYLREMEVKCKPKSG
YMQKQPDITGNMRAILVDWLVEVGEEYKLQNETLYLAVNYIDRFLSSMSVLRGKLQLVGT
AAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLKMEHLVLKVLSFDLASPTILQYLNQY
FQIHPVFPKVESLSMFLGELSLIDADPFLRYLPSVVAAAAFVIANYTINERTWPDSLVEY
TSYTLETLKPCILDLYQAYLSAASHQQQAVREKYKTPKNHAVSLIDPPELLSIFL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccctctgttgcgggacgagaatcaggaaaatgttcagccccgaaagcccctc
gcccctgtgggtggacgcaccgtgctgggggtcttgcaggaaaaccaccggggccgccag
gcgctgaaaacgggcaagccggccctccagcagactcaggttttgtccgttaatcactta
ggagttaatgatgagaattatggcaagataccggcaggaaaagccgccaacaaacagcca
acttttacaatccacgtggatgagccagactgtgcaaataacagaagaaagcctgttcat
aagaagaccgttcaagatgaaaatctacgacaactaaatacggttctgggtaccattggt
actagaaaacctttagaacctatccagattgcaatggaaactagctttggctctcctatg
gatatgtcaattgtggatgaagaacaaaaagtagtcgcttgtagtaatgttcttgattat
gctaaagagattcacacgtacctgcgagaaatggaggtgaaatgtaagccaaagtctggt
tacatgcaaaaacaaccagacataaccggcaacatgagagctatccttgtcgactggctg
gttgaagttggtgaggagtataagctgcaaaatgagaccctgtaccttgctgttaactat
atagatcggttcctttcgtctatgtctgtattgcgaggcaagctccagttggttggaacc
gctgcaatgcttttagcatcaaaattcgaggaaatctatcctcctgaagtggcggagttt
gtttacattaccgatgatacatacacaaagaaacaggttctcaagatggagcatctggtg
ctcaaagttctctcctttgaccttgcttctccaactattttacaatacctcaatcagtac
ttccaaatacatcctgtctttccgaaagtggaaagcttaagcatgttcttgggagagctc
agcttgattgatgccgatcctttcctgcggtatctgccctctgttgttgctgctgccgca
tttgtcattgcaaactacacaattaatgagagaacttggccggattctctggtggagtac
acaagctacacacttgaaacacttaaaccctgtattttggacctataccaggcctacctc
tctgcagcaagtcaccaacagcaagctgtgcgagagaaatacaaaactcctaagaatcac
gctgtatctcttattgatcctccagaattgctgtctatatttttataa

DBGET integrated database retrieval system