KEGG   Xenopus laevis (African clawed frog): 734851Help
Entry
734851            CDS       T01010                                 

Gene name
bdh2.L, bdh2
Definition
(RefSeq) 3-hydroxybutyrate dehydrogenase 2 L homeolog
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00072  Synthesis and degradation of ketone bodies
xla00650  Butanoate metabolism
xla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    734851 (bdh2.L)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    734851 (bdh2.L)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     734851 (bdh2.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR AlaDh_PNT_C ADH_zinc_N NAD_binding_10 Sacchrp_dh_NADP UDPG_MGDP_dh_N FtsJ 3HCDH_N DUF2325 DUF1776
Motif
Other DBs
NCBI-GeneID: 734851
NCBI-ProteinID: NP_001089786
Xenbase: XB-GENE-985759
UniProt: Q3KPT7
Position
1L
AA seq 245 aa AA seqDB search
MGRLDGKVIVLSAAAQGIGRAAAIAFAKEGAQVIATDVNEMKLKELEAYKGIQTRVLDVT
KKDQIENLCKEIDRIDVLFNVAGFVHHGTILDCTEADWDFTMNVNVRSMYFMIKTFLPKM
LAQKSGNIINMSSVASSIKGVVNRCVYSTSKAAVIGLTKSVASDFIDQGIRCNCICPGTV
DTPSLRERIQARPDPEQALKDFLARQRTGRMATAEEVAHLCVYLASDESAYVTGNEHIID
GGWSL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgggccgtttggatggaaaagtgattgttctgtcggctgcagcacaaggaattggaagg
gctgctgccattgcctttgctaaggaaggagctcaggtcattgcgacagacgtcaatgaa
atgaagctgaaagaactggaagcttacaaaggtattcagacaagagttttggatgtcact
aaaaaggatcaaattgaaaatctatgcaaagaaattgatagaatcgatgttctcttcaat
gtagctgggtttgtgcaccatggaaccatactggattgcacggaggcagactgggacttc
actatgaatgtaaatgtccggagcatgtacttcatgattaaaacattcttaccaaaaatg
cttgcacagaaatcaggaaatattatcaacatgtcttccgtggcatcaagcatcaaaggc
gtggtgaacaggtgtgtgtacagtacatcaaaagcagcagtcattggtctgaccaaatct
gttgcatcagacttcattgatcaaggcatccgttgtaactgtatttgtccagggactgtg
gacactccatctttaagagaaaggattcaagcaaggccagaccctgagcaggctttaaag
gacttccttgctagacaaaggactggcagaatggctactgcagaagaagttgcccatctc
tgtgtgtacctggcatctgatgaatctgcatatgtcactggtaatgagcacatcattgat
ggaggctggagtctatga

DBGET integrated database retrieval system