KEGG   Xenopus laevis (African clawed frog): 734851Help
Entry
734851            CDS       T01010                                 

Gene name
bdh2
Definition
3-hydroxybutyrate dehydrogenase, type 2 (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    734851 (bdh2)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    734851 (bdh2)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     734851 (bdh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 245 aa AA seqDB search
MGRLDGKVIVLSAAAQGIGRAAAIAFAKEGAQVIATDVNEMKLKELEAYKGIQTRVLDVT
KKDQIENLCKEIDRIDVLFNVAGFVHHGTILDCTEADWDFTMNVNVRSMYFMIKTFLPKM
LAQKSGNIINMSSVASSIKGVVNRCVYSTSKAAVIGLTKSVASDFIDQGIRCNCICPGTV
DTPSLRERIQARPDPEQALKDFLARQRTGRMATAEEVAHLCVYLASDESAYVTGNEHIID
GGWSL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgggccgtttggatggaaaagtgattgttctgtcggctgcagcacaaggaattggaagg
gctgctgccattgcctttgctaaggaaggagctcaggtcattgcgacagacgtcaatgaa
atgaagctgaaagaactggaagcttacaaaggtattcagacaagagttttggatgtcact
aaaaaggatcaaattgaaaatctatgcaaagaaattgatagaatcgatgttctcttcaat
gtagctgggtttgtgcaccatggaaccatactggattgcacggaggcagactgggacttc
actatgaatgtaaatgtccggagcatgtacttcatgattaaaacattcttaccaaaaatg
cttgcacagaaatcaggaaatattatcaacatgtcttccgtggcatcaagcatcaaaggc
gtggtgaacaggtgtgtgtacagtacatcaaaagcagcagtcattggtctgaccaaatct
gttgcatcagacttcattgatcaaggcatccgttgtaactgtatttgtccagggactgtg
gacactccatctttaagagaaaggattcaagcaaggccagaccctgagcaggctttaaag
gacttccttgctagacaaaggactggcagaatggctactgcagaagaagttgcccatctc
tgtgtgtacctggcatctgatgaatctgcatatgtcactggtaatgagcacatcattgat
ggaggctggagtctatga

  All links  
No link information was found.   
DBGET integrated database retrieval system