KEGG   Xenopus laevis (African clawed frog): 734985Help
Entry
734985            CDS       T01010                                 

Gene name
josd1
Definition
Josephin domain containing 1
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     734985 (josd1)
Peptidases [BR:xla01002]
 Cysteine Peptidases
  Family C86
   734985 (josd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 201 aa AA seqDB search
MSCVPWKGDKAKSGLEPQEPLPSQIYHEKQRRELCALHALNNVFQDDGAFTRETLQEIFQ
RLSPNTLVTPHKKNMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVNLISLSNVTGFIMN
LPSSLSWGPLKLPLKRQHWICVREVGGNYYNLDSKLKRPEWIGSEDDLRKFLRYHLRGKN
CELLLVVSEEVEVHQRWRTDL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagctgtgttccatggaaaggggacaaggcaaaatctggattggagcctcaagaacct
cttccttcacaaatctaccatgagaaacagcgtcgggaactctgtgccctgcatgccttg
aacaatgtctttcaggatgatggagcattcactcgggaaactctacaggagatatttcaa
aggttgtcccccaacactttggtgacgcctcacaagaagaatatgttgggaaatgggaac
tatgatgttaatgttattatggcagcacttcagaccaagggatatgaagctgtatggtgg
gacaaaaggagggatgtcaatttgatctcgctctctaatgttactgggtttattatgaac
cttccatcaagtctgtcttggggtccccttaagcttccactcaaaaggcagcactggata
tgtgtacgtgaggtaggaggtaactactacaacttggactccaaactgaagaggccagag
tggattgggagtgaagatgatctaaggaaatttttgagatatcacttaagaggcaaaaac
tgtgagctgcttttagtggtatcggaggaggttgaagttcatcagcgctggaggactgat
ctataa

DBGET integrated database retrieval system