KEGG   Xenopus laevis (African clawed frog): 735075Help
Entry
735075            CDS       T01010                                 

Gene name
eif3b, eIF-3-eta, eif3-eta, eif3-p110, eif3-p116, eif3s9, prt1
Definition
eukaryotic translation initiation factor 3, subunit B
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    735075 (eif3b)
Translation factors [BR:xla03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    735075 (eif3b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 688 aa AA seqDB search
MLESERPERDMEEEGEESNEEEEEEGMSFSDPEGFEDDISDEELLGDILKDRPQEADGID
SVIVVDNVPQVGPDRLEKLKNVIVKIFSKFGKLTNEFYPQAEGSTKGYIFLEYALPAQAQ
DAVKNADGYKLDKQHTFRVNLFTDFDKYMVIGDEWDVPEKQPFKDFGNLRSWLEDPDCRD
QFSVIYESGDRTSIFWTDVKEPVPVEERARWTETYVRWSPKGTYLATFHQRGIALWGGEK
FKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTKEEPQAIIIWDILTGHNKRGFHCESSA
HWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKITGIKDFSWSPGGNIIAFWVP
EDKDIPARVTLMQMPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGMVTNF
EIFRMREKQVPVDVVEMKDGIIAFAWEPNGSKFAVLHGEVPRISVSFYHVKNNGKIELIK
MYDKQQANTIFWSPQGQFLVLAGLRSMNGALAFVDTSDCTIMNIAEHYTASDVEWDPTGR
YVITSVSWWSHKVDNAYWMWTFQGRLLQKNNKDRFCQLLWRPRPPSLLSQDQIKQIKKDL
KKYSKIFEQKDRLSQTKASKELIERRRAMMEEYKTYREMATKLYMEQKTARLEIRGGVDT
DLLDSNVEDWEEETIEFFVTEEIIPVEE
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgttggagagtgagcgaccggagagagacatggaggaggagggggaagagtccaacgag
gaggaggaggaagaggggatgtcttttagcgatccggagggattcgaagatgatatcagt
gatgaggagttgcttggtgatatcctgaaagaccgtcctcaagaggcagacggtattgac
tctgtgatcgtggtcgataatgtgccacaggttggacctgaccgtttggaaaagctaaaa
aatgtcattgttaaaatcttctccaaatttgggaaacttaccaacgaattctatccacaa
gcagaaggcagcaccaaaggatatatttttctggagtatgctttgccagcacaggcgcaa
gatgcggtaaagaatgccgacggctacaaactggacaagcaacacacattccgcgtgaat
ctcttcactgactttgacaagtacatggttattggagatgagtgggatgtccctgaaaaa
caaccatttaaagattttggcaatctgcgctcttggcttgaggatcctgactgccgagat
cagttcagtgttatatatgaatcgggcgatcgtacctctatcttctggactgatgtcaag
gagccagttccagttgaggagagagcaagatggactgagacatatgtacgctggtctcca
aaaggcacttaccttgccacgtttcatcagagaggcattgcactttggggtggagaaaag
ttcaagcaaattcagagattcagccaccagggtgtacaactcatcgacttttcaccatgt
gaaagatatctggttacatttagccctctaatggacactaaagaagaaccacaggccata
atcatctgggacatactgacaggccataataaaagaggctttcactgcgagagctctgca
cactggcctatattcaaatggagtcacgatggcaagttctttgctcgaatgacccttgat
actcttagcatttatgaaacaccttccatgggccttttggataaaaagagtttgaagatt
actggaatcaaggacttctcttggtctcctggaggtaacatcatagcattttgggtacca
gaagacaaagacatccctgccagggtgactttaatgcagatgcctaccagacaggaaatc
cgagttaggaatctgttcaatgttgttgactgcaagcttcactggcaaaagaacggtgat
tatctgtgtgtgaaagtcgacagaacacctaaaggaacccagggaatggtgaccaatttt
gagatcttcagaatgcgagaaaagcaggttccagtagatgtagtagaaatgaaagatgga
atcattgcctttgcctgggaacctaacggaagcaagtttgcagtgctgcatggtgaagtc
ccccggatatctgtttcattctaccatgtcaaaaacaacggcaaaattgagcttataaaa
atgtatgacaaacagcaagctaacacgatcttctggagtcctcaggggcagtttttggta
ttggctgggcttagaagcatgaacggggctttagcctttgttgacacgtctgactgcact
ataatgaatatagctgaacactatacagcctctgatgtggaatgggatccaactgggcgc
tatgttatcacatctgtttcatggtggagccataaagtggataacgcttactggatgtgg
acattccaaggccgccttcttcagaagaacaacaaggacagattctgccagcttctctgg
agaccaaggcctccatcattgcttagccaagatcaaataaagcaaatcaagaaggatttg
aagaagtactccaagatatttgaacaaaaagatcggttaagccaaaccaaagcctcaaag
gaactgatagaacgcagacgagccatgatggaagagtacaagacataccgggagatggca
acaaaactatacatggaacagaaaactgcccgtctggagatcagaggaggtgtggacacc
gatttgctggacagcaatgtggaagactgggaagaggagaccattgagttctttgtaact
gaagaaattatcccagtggaagagtag

DBGET integrated database retrieval system