KEGG   Xenopus laevis (African clawed frog): 735104Help
Entry
735104            CDS       T01010                                 

Gene name
dao.L, dao
Definition
(RefSeq) D-amino-acid oxidase L homeolog
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00260  Glycine, serine and threonine metabolism
xla00330  Arginine and proline metabolism
xla00472  D-Arginine and D-ornithine metabolism
xla01100  Metabolic pathways
xla04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    735104 (dao.L)
   00330 Arginine and proline metabolism
    735104 (dao.L)
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    735104 (dao.L)
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    735104 (dao.L)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    735104 (dao.L)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     735104 (dao.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 735104
NCBI-ProteinID: NP_001090031
Xenbase: XB-GENE-976204
UniProt: Q4QR47
Position
1L
AA seq 347 aa AA seqDB search
MHITVVGAGVIGLSTALCIHENYHRIVRPLKIEIYADKFSPLTTSDGAAGLWQPYLYDNG
NTQETKWNKETFDHLLKFVHSSEAPNMGLFLQSGYNILKEPAPEPSWKDIILGFRHLTPE
ELELFPGYSYGWFNTAIMIEGKHYLPWMMKRLEERGVKFVHKRIESFGELAVQGADVIIN
CTGIRSGELQPDPELKPGRGQILKVHAPWMKHFILTHDLKTGVYTTPYIIPGSESVTLGG
IYQLGNWSEENTSEDYKWIWENCCELVPSLKNAKIVNAWAGLRPTRSKVRLEREAFVSGS
MKSQIIHNYGHGGYGLTIHWGCAMEAAKIFGQIIKERNLKKTPQSSL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcacataactgttgttggagcaggagtgattgggctctccacagcattatgtatccac
gagaattaccaccgcattgtacgacctcttaagattgaaatctatgcagataaattctcc
ccactcaccaccagtgatggagcagcagggctgtggcagccatatttatatgacaatggc
aacacacaggaaaccaaatggaacaaagagacttttgatcacttactcaaatttgtccat
tcatcggaagctccaaacatgggactattcctgcaatccggttacaatatccttaaggaa
ccagcgcctgagccatcctggaaggatattatccttgggtttcggcatttaacacccgaa
gagctagaactgtttcctggctacagctatggatggtttaacactgcgataatgattgag
ggaaaacactacttaccatggatgatgaagaggctggaggagcgaggagtgaagttcgtt
cataagagaattgaaagctttggtgaactggctgtacaaggagcagacgtcatcattaac
tgcactggaatacgttctggagagctgcagcctgatccggaattaaaaccaggccgaggg
cagatcctaaaggtgcatgcaccttggatgaaacactttattttaactcatgatctgaag
actggtgtttataccacaccatatattataccaggctcagagtctgtcacattgggagga
atttatcagcttggaaactggagtgaggaaaacacttctgaggattacaagtggatttgg
gaaaactgttgtgagttggtgcccagtcttaagaatgcaaagattgtgaatgcctgggcc
ggattgagaccaacacgcagcaaagtgagactggagagggaagcctttgtttctggatct
atgaagagtcagataattcacaactatggccatggtggatatggcctaacaattcactgg
ggatgtgcaatggaggcagctaagatctttgggcagattattaaagaaaggaaccttaaa
aagactccacagtcttccctttga

DBGET integrated database retrieval system