KEGG   Xenopus laevis (African clawed frog): 735153Help
Entry
735153            CDS       T01010                                 

Gene name
LOC100145045.L
Definition
(RefSeq) mitogen-activated protein kinase 12 L homeolog
  KO
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Cellular senescence
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
AGE-RAGE signaling pathway in diabetic complications
Salmonella infection
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    735153 (LOC100145045.L)
   04370 VEGF signaling pathway
    735153 (LOC100145045.L)
   04068 FoxO signaling pathway
    735153 (LOC100145045.L)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    735153 (LOC100145045.L)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    735153 (LOC100145045.L)
   04621 NOD-like receptor signaling pathway
    735153 (LOC100145045.L)
   04622 RIG-I-like receptor signaling pathway
    735153 (LOC100145045.L)
  Endocrine system
   04912 GnRH signaling pathway
    735153 (LOC100145045.L)
   04914 Progesterone-mediated oocyte maturation
    735153 (LOC100145045.L)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    735153 (LOC100145045.L)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    735153 (LOC100145045.L)
  Infectious diseases
   05132 Salmonella infection
    735153 (LOC100145045.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     735153 (LOC100145045.L)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   735153 (LOC100145045.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
UniProt: 
Position
4L
AA seq 359 aa AA seqDB search
MESGARKGFYRQDINKTKWEAPVRYRELAAVGSGAYGTVCSAQDRLTGERVAIKKLLRPF
QSLVHAKRAYRELRLLKHMKHENVISLLNVFTPDESVETFQTFYLVMPFIAVDLSRVMRM
QRLNQSTIVYLLYQILRGLQYIHSAGIVHRDLKPSNLGVNEDYELKILDFGLARQTEFEM
TGYVVTRWYRAPEVILNWMHYNQTVDIWSVGCILAEMITGKVLFPGGDYFDELNRIIEVT
GSPQPSLINKMESSHAQDYVRMLPKKQKKNFKELFPTMSSIETELLEKMLDLDPEKRINA
TEALAHPYLEEYNDSDPDPPAEKYDDSFESLDLDVHEWKSLSHMEIMTFEPMKQSQAAS
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggagtctggggcaaggaaaggtttctataggcaggacattaacaagaccaagtgggaa
gcgcccgtgcgatacagagaactggctgcagtgggctcaggagcctatggaactgtatgc
tctgctcaagaccgcctgacaggggagcgggtggccataaagaagcttcttcgtccattt
cagtcattggttcatgccaaaagagcctatcgggagcttcgcctgctcaagcacatgaag
catgagaatgtcatttctctccttaatgtctttactccagatgagtcggtggaaaccttt
cagacattttacctggttatgccattcatcgctgttgacttaagccgagtcatgagaatg
caaagactcaatcaaagcactatagtgtaccttctctaccagatcctgcggggcctccag
tatatccactcggctggaattgtccacagggatcttaaaccaagtaatctgggagtaaat
gaagactatgagctaaagattttagattttggactcgcccggcaaactgaatttgaaatg
acaggctatgtggtgactcgctggtaccgcgctccagaggtgattctgaactggatgcat
tacaaccaaacagtggatatttggtcagttggatgtatcctggcagaaatgatcactggc
aaagtcctgtttcctggcggagactattttgatgagctaaacaggatcattgaggttaca
ggaagtccacagccatcactgatcaacaagatggaaagctcacatgctcaagactatgtg
agaatgctccccaagaaacaaaaaaagaattttaaggagctctttccaactatgagttca
atagagacggaactcttagagaagatgctggatctagaccctgaaaaaagaatcaatgca
acggaagccctagcacatccatatcttgaggaatataacgattctgatcctgatcctcct
gcagagaaatatgatgactcatttgaaagcctagatctggatgtccatgagtggaaaagt
ttgagccacatggaaataatgacgtttgagccaatgaaacagagccaagcagctagttaa

DBGET integrated database retrieval system