KEGG   Xenopus laevis (African clawed frog): 735204Help
Entry
735204            CDS       T01010                                 

Gene name
uchl1
Definition
ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
Orthology
K05611  
ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
xla  Xenopus laevis (African clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 223 aa AA seqDB search
MQWRAMEINPEMLNKVLSQLGVSGAWKFVDVLGFEDESLNNVLTPVCALLLLFPLTPQHE
NFRKCQIKELQEKNANNKVYFLKQTIGNSCGTVGLIHAVANNKDKFNFAENSVLKGFIEQ
TAALSPEERAIHLEKNEAIKSAHNSVAAEGQCRENSDVNFHFILFTAVDGHLYELDGRLP
SPVEHDPTSEGTLLKDAAKICRQFTEREQGEVRFSAVALSKSA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggagagcgatggaaatcaatcctgagatgctgaacaaagttttgtcccagttg
ggtgtgtctggtgcctggaaatttgtggatgtcttgggatttgaggatgaatctctgaac
aatgttctcacaccagtctgtgcattactgctacttttccctcttaccccacagcatgaa
aactttagaaagtgccaaataaaggagctgcaagagaagaatgcaaacaataaagtgtat
ttcttaaaacagaccattggtaattcctgtggtacagttgggcttattcatgctgtggct
aataataaagataaatttaattttgctgaaaactcagtgttaaagggttttatcgaacaa
actgctgcgctttcacctgaagaaagggcaatacacctagaaaaaaatgaggctataaag
tctgctcacaactctgtggctgctgaaggacaatgcagggagaacagtgatgtaaacttt
cattttatattgttcactgctgttgatggacatctttatgagttggatggcagacttcct
tcccctgtggaacatgatccaacctctgaaggcactttactaaaggatgcagccaaaata
tgcagacagtttactgagcgtgaacaaggagaagttcgtttttctgctgtggctctaagc
aaatctgcttaa

DBGET integrated database retrieval system