KEGG   Xenopus laevis (African clawed frog): 735225Help
Entry
735225            CDS       T01010                                 

Gene name
plcd4
Definition
(RefSeq) phospholipase C, delta 4 (EC:3.1.4.11)
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    735225 (plcd4)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    735225 (plcd4)
   04070 Phosphatidylinositol signaling system
    735225 (plcd4)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    735225 (plcd4)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     735225 (plcd4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 758 aa AA seqDB search
MTSPCSARLQLDENLQLMQAGSPMRKVKSRSWKKQRYFKLQEDCMTIWYNSKKTGNTKST
FSISDIETVREGHQSEVLQSIAEEFKPELCFTIVFHGRRANLDLVANTPEEAQCWIQGLE
KLIETVTNMDRKDLMDQWICDWFQKADKNKDGRMNFKEVQDLLKMMNVDMSEHHAFRLFQ
MADKSESGTLEGEEFVLFYKALTQRDEVLKIFQDFSKDGKKLTLLEFVDFLQQGQLEEEN
TEEIAMDLIARYEPSDTAKKLHAMSIDGFLVYLCSPEGSIFNVAHEQLYQDMMQPLCHYF
ISSSHNTYLMEDQIRGQSSIEGYIRALKRGCRCVEVDTWDGPNGEPIVYHGRTFTSKILF
KDVISAIDKYAFRVSDYPVILSLENHCGVEQQDAMAQHLKSILGNKLVMSTLDGRIPVRL
PSPDELRGKILLKGKKIGRLEDSLEEQPDDSLGEVSDEEENIEVEEERNEDKKRAKKSKE
RLSQELSDCVIYCKSVPFVSFQHSRAHYILYEMSSVTEYKARKLVREPGNDFVRHNAWQL
MRIYPTGLRTDSSNYNPQDMWNVGCQMTALNFQTAGVEMDLNDGLFRQNARCGYVLKPSF
MRHVETTFNPDQPQGTEGYSPVNLSILVISAQQLPKVENSKEGSIVDPLVRVEIFGVPID
QTKQETKYIENNGFNPMWYETLHFKIHVPELALVRFVVEDYDKTSRNDFVGQYTLPFKSI
KSGYRHIHLLSRDGTKIPPASLFVHIRVTDASQPEQDT
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgacatctccatgctctgcccgcctacagctggatgagaacctgcagctcatgcaggct
gggtcccctatgagaaaagtaaaatcccgaagctggaagaaacagagatatttcaaactg
caggaggactgcatgactatctggtacaactcaaaaaaaactgggaacacaaaatccaca
ttttccatcagtgacattgagacggtgagggaaggacatcagtcagaagttctgcagagt
atcgcagaggagttcaagcctgagctttgctttaccattgtgttccatggtcgtcgagcg
aacctcgacttggtggcaaataccccagaggaggctcaatgctggattcaaggcctggag
aaactgatagagacagtgacaaatatggaccggaaggacttgatggatcagtggatctgt
gactggttccaaaaggctgacaagaacaaagatggaagaatgaactttaaagaagtacag
gatctgctaaagatgatgaatgtggacatgagtgagcaccatgctttccgtctgttccag
atggcagataagtcagagtcaggaaccttagaaggagaggagtttgtgttgttttacaaa
gctctgacacagcgtgacgaggtgctaaagatatttcaggacttctccaaggatggaaag
aagctaaccctattggagtttgtggactttttacagcagggccaactagaggaagaaaac
acagaggagatagcaatggaccttattgcccgttatgagccatcagatactgcaaagaaa
cttcacgctatgagtatagatggctttctcgtgtacctgtgctccccggagggatccatt
ttcaacgtggctcatgagcagctctatcaggatatgatgcagccattgtgccattacttc
atctcatcatctcacaacacctacctgatggaggaccagatccgaggacagagtagcatt
gagggatacatcagggcactaaaacgaggctgtcgttgtgtggaagtggacacctgggat
gggccgaatggagaacccattgtgtatcacgggcgcaccttcacatctaaaatcctcttc
aaagatgttatttcagccatcgacaagtatgccttcagggtatctgactacccagtcatc
ttgtccttggagaatcactgtggggtggaacaacaggatgccatggctcagcacctgaaa
agcattctgggaaataaacttgtcatgagcaccctagatggtcgaattcctgtccgtttg
ccatctcccgatgaactgcgagggaagatcctactaaaggggaagaaaatcggtcgattg
gaagacagcctggaggagcagcctgatgattcattgggtgaggtgtcagacgaggaagag
aacattgaggtggaagaggagagaaatgaggataaaaaaagggcaaaaaagtccaaagaa
cgcctctctcaggagctttcggactgtgtcatttactgtaagagtgtgccatttgtaagc
ttccagcattccagagcccactacatactttacgagatgtcatcagtcacagagtacaag
gctaggaagcttgtacgagaaccagggaatgattttgtccggcacaacgcctggcagctg
atgcgtatttaccccacaggactcaggacagattcttccaattacaacccccaagatatg
tggaatgtcgggtgccaaatgacggcactaaacttccagacagccggagtagagatggat
ctgaatgatggcctcttccgtcagaacgctcgctgtggctacgtgctgaagccttcattc
atgagacatgtggagactacgttcaatccagatcaaccacaaggcacggaaggatactca
cctgtcaatctgtccatactagttatcagtgcccagcaactgcctaaggttgaaaacagc
aaagaaggttccattgtggatcctttggtgagagtggagatatttggggttcccattgac
caaacaaagcaggagacaaaatatatagaaaataatgggtttaacccaatgtggtatgag
acactgcacttcaaaatccacgttcctgaactggcgcttgttaggtttgtggtagaagat
tacgacaaaacatcaagaaacgactttgtcggacagtatactctcccgttcaagagcata
aaatctggatatcgccatatccacctcctctcacgagatggcacaaagattccgcctgcc
tctttgtttgttcacatccgagttacagatgcatcacagccagagcaagacacgtag

DBGET integrated database retrieval system