KEGG   Xenopus laevis (African clawed frog): 779144Help
Entry
779144            CDS       T01010                                 

Gene name
usp22_b, usp22-B
Definition
ubiquitin specific peptidase 22 b (EC:3.4.19.12)
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     779144 (usp22_b)
Peptidases [BR:xla01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   779144 (usp22_b)
Transcription machinery [BR:xla03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     779144 (usp22_b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 572 aa AA seqDB search
MSGSWTPSKEFLLRQNWEGGRLSAFSSSSLGRSPSCPRTPHLVSGCGFVMSPAGCSHVNS
FKVENWRQNLRVIYQCFVWSGTPETRKRKAKSCVCHMCGAHLNRLHSCLYCVYFGCFTKK
HIHEHAKNKRHNLAIDLLYGGIYCFMCQDYIYDKDMEQVAKEEQRKAWKLQVFSPALVSP
YQYTMTGVGEKYSTWEPTKRELELLQHNPKRRKITTNCTIGLRGLINLGNTCFMNCIVQA
LTHTPLLRDFFLSDRHKCEMQSPNSCLVCEMSTLFQEFYSGHRSPHIPYRLLHLVWTHAR
HLAGYEQQDAHEFLIAALDVLHRHCKGDDNGKKANNPNHCNCIIDQIFTGGLQSDVTCQV
CHGVSTTIDPFWDISLDLPGSSTPFWPLSPGSDAGVVNGESHVSGTTTLTDCLRRFTRPE
HLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRRKITTYVSFPLELD
MMPFMASSKESRMNGQYQQPSDSLHNDNKYSLFAVVNHQGTLESGHYTSFIRQHKDQWFK
CDDAIITKASIKDVIDSEGYLLFYHKQFLEYE
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtctggttcttggaccccttcgaaggagtttttgctgagacaaaattgggaggggggg
aggctttcagccttctcctcctcctccctggggagaagtccttcctgtcctcggacccca
cacctagtgagtggatgtgggtttgtcatgagtccggccggctgctcccatgtgaacagc
tttaaggtggagaattggaggcaaaacctgcgagtaatttaccagtgctttgtgtggagt
gggactcctgaaaccaggaagaggaaggctaagtcgtgcgtctgtcatatgtgtggagct
cacttgaacagacttcactcttgtctctactgtgtttactttggctgctttacgaagaaa
catattcacgaacacgcaaaaaataagagacacaatctggctatagatctattgtatggg
ggtatatactgctttatgtgtcaagattatatatatgacaaagatatggagcaagttgcc
aaagaagaacaacgaaaagcttggaaattgcaagttttttcccctgcactggtttctcca
taccagtatacaatgactggagttggagaaaagtattcaacatgggagccaacaaagcgg
gagctagagctgttacagcataaccccaaaagaagaaaaattaccacaaattgtactata
ggtttgcgaggtttaattaatcttgggaacacgtgttttatgaactgtattgtccaggca
ctaacccatactcccttgctacgagatttcttcctttcggacagacataaatgtgaaatg
caaagtccaaactcttgccttgtttgtgaaatgtctacgctctttcaggagttttactcc
ggacaccgttctcctcacattccatataggttactgcaccttgtatggacacatgcacgg
catttagcagggtacgagcagcaagatgcacacgagttcctcattgctgctttagatgtt
ctgcacagacattgtaaaggggatgataatgggaaaaaggccaacaatccaaaccactgt
aactgtatcatagaccaaatcttcacaggaggcctacagtcagatgtaacctgtcaagtg
tgccatggggtttctacgactatagatccattttgggacatcagcttagatctgccaggc
tcttcaactccattctggcctctgagcccaggaagtgatgctggtgttgtgaatggggaa
agtcatgtgtcaggaacaacaacgctcacagactgtctcaggaggtttacgcgaccagag
catctaggaagtagtgccaaaatcaaatgcagcggttgccatagctaccaggaatctacg
aaacagctgactatgaagaaattgcctattgtggcttgttttcatctcaaacgatttgag
cattcggctaaactgaggcggaagattacaacatatgtgtcattccctttggagctggac
atgatgccatttatggcttccagtaaagaaagccgaatgaatggacagtatcaacaacca
tctgatagtttacacaatgacaataagtattcattgtttgcagtagttaaccaccaggga
accttggagagtgggcattacacaagcttcatcagacaacacaaggaccagtggttcaaa
tgtgatgatgcgattattaccaaggctagcattaaagatgttatagacagtgaagggtat
ttgcttttctatcacaagcagtttctggagtatgagtaa

DBGET integrated database retrieval system