KEGG   Xenopus laevis (African clawed frog): 779202Help
Entry
779202            CDS       T01010                                 

Gene name
usp10, usp10-A
Definition
ubiquitin specific peptidase 10 (EC:3.4.19.12)
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     779202 (usp10)
Peptidases [BR:xla01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   779202 (usp10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 791 aa AA seqDB search
MASPSEQYIFGEFSDDEFKQFFVTARCTVELPPYNEHFFPCGPQSSGDFQDGEECPRIEF
GIEEVIDHNTTLPNNTDYSISSNLNPQAPEFILTCSSSPKDSNNVLHENNFDAIDCQFSE
SSIPDGSGNADSDGTSGTGQRERKKKKKRPPGYYSYLEGVGDVPSETLLNGHANSAGLNS
ISTDDPDLAEDIPISTTSPRTCTSPDNFVDLNNEALSDDASMHNVLDNTRTAGQPEECSV
TSSEQSCIPSDNGRESPVRTAVVQPFAGTDTTENLGVTNGQTLESPEEDTASNGVVLHPE
VISLSEEAKAEEISTAQAVIHLPGSASANAPAKSWASLFHNSKPSSTPQVAYVETKNTPP
VTSLQVTEKQVEIKEGPVPVSEDPVAIKIAELLEEVKLVHKPVSLQPRGLINKGNWCYIN
ATLQALVACPPMYHLMKSIPVYTKAQKPCTSTPMIDSFVRLMNEFTNMPILPKAKQAPGE
KVVRDIRPGAPFEPAYIYRLLTVFKSSLSEKGRQEDAEEYLGFILNGLHEEMLALKKLLL
PQNDKIHINNGPDPVFATEEVNKEEQEGSDEEWEQVGPRNKSSVTRQADFVQTPITDIFG
GHMRSVVYQQSSKESATLQPFFTLQLDIQSEKIRTVQDALESLVARESVQGYTTKTKQEV
EICRRVTLEELPPVLVLHLKRFVFEKTGGCQKLIKNIEYPVDLEISKDLLSPGVKSKIFK
GQRTYRLFAVVYHHGNSATGGHYTTDVFQIGLNGWLRIDDQTVKVINQYQVVKQTVERTA
YLLYYRRVDLL
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggcctccccgagcgaacagtatatatttggggagtttagtgatgatgaattcaagcag
ttctttgtgacagctcgctgcacagttgagttgccaccttacaatgaacatttttttcca
tgtggtcctcagtcttcaggtgattttcaggatggggaggagtgtccaagaattgagttt
ggtattgaagaagtaattgaccacaatactaccctaccaaataacacagactacagtatt
tcaagtaacttaaatcctcaggctcctgagttcattctcacctgttcatcttctccgaaa
gattcaaataatgttctccatgaaaataattttgatgccattgattgccagttctcggaa
tcttccattccagatggcagtggcaatgcagatagtgatggtacatctggcactggacag
cgagagcgtaaaaagaagaaaaaaagacctccagggtattatagttacttagaaggtgtt
ggagatgtcccttcagagacccttttaaatggacatgccaactcagcaggacttaacagt
ataagcacagatgaccctgatcttgcagaagatataccaatatctacaacctctcctagg
acttgtaccagtccagataattttgtggaccttaataatgaagctctttctgatgatgct
tctatgcataatgtactagacaataccaggactgccggtcagcctgaggaatgcagtgtt
actagttcagaacaatcttgcatcccctcagacaatggaagggagagcccagtaaggaca
gctgttgtccagccttttgctggtactgatactactgaaaaccttggagttaccaatgga
caaacacttgaatccccagaggaggacactgcatctaatggagtggtattgcatcctgag
gtcatttccctctcagaggaagctaaggcagaggaaatttcaactgctcaggctgtaata
catcttcctgggtcagcctctgcaaatgcaccagctaagtcctgggctagtctttttcac
aattccaagccctcatcaaccccacaggtggcttatgtggagacaaagaatactccccct
gtcacatctctacaagttacagagaaacaagttgagattaaagaagggcctgttcccgtg
tcggaggatcctgtagccataaagattgcagaactcttggaggaagtcaaacttgttcac
aaacctgtttcgttacagccacgaggattaattaacaaaggaaactggtgctatattaat
gctacattgcaggctctggtggcctgtcctcccatgtatcaccttatgaagtccattcca
gtatatactaaagctcagaagccatgtacatctactccaatgatcgacagttttgtacgt
ttaatgaatgagttcacaaacatgccaatactcccaaaagcaaaacaagctcctggtgag
aaagttgtaagggatatacgtccaggtgctccgtttgaaccagcatacatttaccgctta
cttactgttttcaaatcaagtctttcagaaaagggccgtcaggaagatgcagaagagtac
cttggattcattttaaacgggttacatgaagagatgctagctctcaagaagcttcttttg
ccccaaaatgacaaaatccacattaacaatggcccagatcctgtgtttgcaacagaagaa
gttaacaaagaggaacaagaaggcagtgatgaggaatgggaacaagtggggcctcgcaac
aagtcatcagtgacacgtcaagcagactttgttcagactcctataacagatatatttgga
ggacatatgagatctgttgtgtaccagcagagctccaaagaatctgccactcttcagcca
ttttttactctgcaactggatatccaatctgaaaagatccgcactgtccaagatgcactt
gagagcctagtggctagagagtctgtccagggctacaccaccaaaacaaaacaagaggtg
gagatctgtcgaagagtcaccttggaagaactcccacctgtgctagtgttgcacctcaaa
cggtttgtgtttgagaaaaccggaggatgtcagaaacttatcaagaacatagagtaccca
gtggatctggaaattagtaaagatctgctttctccaggagttaagagcaagatattcaaa
ggccaaagaacctacaggctctttgcagttgtttatcaccacggaaacagtgcaactggc
ggccattacactacagatgtcttccagattggtcttaatggctggttacgtatagatgac
cagactgtcaaagtgataaaccagtaccaggtggtgaaacagactgtggagcgtacagcc
tacctcctgtattaccgccgcgtagatctgctgtga

DBGET integrated database retrieval system