KEGG   Xenopus laevis (African clawed frog): 779229Help
Entry
779229            CDS       T01010                                 

Gene name
art5
Definition
ADP-ribosyltransferase 5 (EC:2.4.2.31)
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     779229 (art5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 324 aa AA seqDB search
MDHLMKLWPIVWVLLQPITTQEIFSVAPMDVSKDTFDDQYIGCRDQVDLLMEEILKTEKS
ENKFFRRAWTEAEKIWNIKKNKIWSELPDGFRDNHGVALVAYSGFIKTYFDEAIISAGRS
YNDYMQSFKYKSLHFYLSVAVQLLSGCRAKMVYVGIKGLWYPTNSTSDGVKFGHFVTTYS
EKEQAMDSGNDTVLYIQSCHGVQMEMFSQFPHERAVLVPGYEIFSVYEGEPNEFVLISTK
KSCSKFNCALIRGERPLGCAPYSGETPRISSSATRDLPFNLIITAVSLLLGPQLLRLPTS
EINFLFLLLVLWPLPVRADEVDIM
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggatcatctgatgaagttgtggccaatcgtttgggtcctgctccagcccataactaca
caggaaatcttctcagtggcacccatggacgtctcaaaagatacatttgatgaccagtat
attgggtgccgggatcaagtggaccttctcatggaggagatcctgaagactgagaaatca
gagaataaatttttcagacgagcttggaccgaagcggaaaaaatatggaacatcaagaaa
aataagatctggtctgagcttccagatgggtttagagataaccatggggtcgccttggtg
gcttattctggatttattaaaacatactttgatgaagccattatatctgctggcaggtcc
tacaatgactatatgcaaagcttcaaatacaaatccctccatttctacctgagtgtggcg
gtgcagctgctgtctgggtgcagagccaagatggtttatgttgggataaaagggttatgg
tacccaaccaactctacatcagatggagtcaagtttggccattttgtgaccacctactca
gagaaggaacaggctatggactctggcaatgacacggtcttatatatccaaagctgccat
ggggttcagatggagatgttctcccagttcccccatgaaagggcagttctagttccgggc
tatgagatcttctcagtttatgagggagaacccaatgaatttgtgttaatcagcaccaaa
aagtcctgcagcaaatttaattgtgccctaattagaggtgagagacccctggggtgcgcc
ccctactccggtgaaacacccaggatctccagctcagcaactcgtgatttgccctttaat
ctgatcatcactgcggtgtcactgctgttgggcccccaactgttacgacttcccacctct
gaaattaactttctctttctgcttctcgtgctctggcccctccctgttagagctgacgag
gtcgatatcatgtga

DBGET integrated database retrieval system