KEGG   Xenopus laevis (African clawed frog): 779325Help
Entry
779325            CDS       T01010                                 

Gene name
anapc5
Definition
anaphase promoting complex subunit 5
Orthology
K03352  
anaphase-promoting complex subunit 5
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    779325 (anapc5)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    779325 (anapc5)
   04114 Oocyte meiosis
    779325 (anapc5)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    779325 (anapc5)
Ubiquitin system [BR:xla04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     779325 (anapc5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 319 aa AA seqDB search
MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKISVLVLLSEMSKNTKISLVEKRRLNK
QILPLLQGPDMTLSKLIKIVEECCPNVSSSVHIRIKLMAEGELKDMEQFFDDLADSFTGT
EPEVHKTSVVGLFLRHMILAYNKLSFSQVYKLYTSLQQYFQSEKSKATSKTDSDEADMDL
TNNDEEEGKLEKEDLDFPIGEDDLACSGPLSQKQAEYFLSQQASLMKSDENKALTPVLLQ
KELNNLLKFNPDFAEAHYLSYLNSLRVQDVFSSTHSLLHYFDRLILTGAESKSNGDEGYG
RSLRYAALNLAALHCRFGH
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgttcatgaaagcctgtattttaaccccatgatgaccaacggggtagttcac
gccaatgtgttcggtataaaggactgggtgacgccgtacaagatctcagtgctagtgttg
ctgagcgagatgagtaagaatacgaaaatcagcttggtggagaagaggcgcttaaacaag
caaatccttcccctcctgcagggaccagatatgactctttctaaactaattaagattgtt
gaagagtgctgtccaaatgtctcaagctctgtccatatcagaataaagttgatggctgaa
ggagaactaaaggacatggagcaattctttgatgatcttgctgattcctttacaggaact
gaacccgaagtgcacaaaacaagtgttgttggacttttccttcgacacatgatcttggca
tacaacaaactttccttcagtcaagtatacaagctgtacacttcgttgcagcaatatttt
cagagtgagaaaagcaaggccacttcaaagacagatagtgatgaggcagatatggatctt
actaacaatgacgaggaagaaggaaaactggagaaagaagatctggatttccctattggg
gaggacgacttggcttgcagtggcccattatcccagaaacaagcagaatatttcctctct
caacaggcctctttaatgaagagtgatgagaacaaggccctgaccccagtcttactgcaa
aaggaactaaataatctgttgaagttcaaccctgatttcgcagaagctcattacttaagc
tatttaaacagtctgcgtgttcaagatgtgttcagttcaacacatagcctattgcattac
tttgaccgcttgattctcactggtgcagagagtaaaagtaatggagatgaaggatatggg
cggagtttgcgatatgctgcattgaatcttgctgccctgcactgccgctttggacactag

DBGET integrated database retrieval system