KEGG   Xenopus laevis (African clawed frog): 779334Help
Entry
779334            CDS       T01010                                 

Gene name
tacc3
Definition
transforming, acidic coiled-coil containing protein 3
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    779334 (tacc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 884 aa AA seqDB search
MSLQLINDENAGNDITAEKCDLLFSPPTTGRPSILRPSQKVNLPPKPTLKSIKVTFQTPM
RDPQTQRIMTPSVANKPANAFLLEDCTQALEQLHLSVPSNCGPNPVETNKLVSANQPDSD
ELPMSSTGAYSIDFDNLDNLNPFKSKTQMLNSPIKADLPSHMENMEATTPVIPAGEASKH
MESSNTSAANLDSPVTVQFSSESNTVGVSDKYALDDTLPLSESGIKDLQGSNKSSNSIEE
PVSLDKDMCSSNEKNVEAVTDEANSDAQSSPPVPKSSYSFDLDHIDMINPFKTGGSKLQN
SPAGVKQTPPPEDVNVAKTEPVKLEFNFSDGDAPARKPPPKKLGKRPPVKTATKKPVPKQ
ETTAEKQETQTAKPVEDEVVVPKASYEFDWEKFDDPNFNPFGCGGSKVSSSPKGQKVANE
VQAACKPKAEDTDLTPAENADGKKDLGEIEPAQDSGVAEDKSHTEDQPVVLSNADLPHEQ
TTESSPVENETQPEICTVRDEPFQKEVDHRSPDITPPEINGTDSEFKLATEADFLPAADM
DFKPASEIFSEGFGHPIEIDYLENFGSNSFKESALRKQSLYLKFDPLLRESPKKNAAGNS
LLPSVPLKSSFELFGGISEVNFPLIPSFENEEKPKGLDLLGTFTVADAAPLIVDAPSSVA
VPDPFLLTSDAIVEVLKYSQKDMDAAIEAVRLEVQEKDLEVLEWKNRHEKLYLEYVEMGK
IIAEFEGTITQMLEDSQRQKEMSKLEINKVLQEKQQVQVDLNSMEKSFSELFKRLEKQKE
VLEGYRKNEEALKKCVEDYLARIKKEEQRYQALKAHAEEKLNRANEEIAHVRSKAKAEST
ALQATLRKEQMKTQSLERSLEQKSKENDELTKICDDLILKMEKI
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atgagcctacaactcataaacgatgaaaatgcaggaaatgatataactgcagagaagtgc
gacttgttgtttagtcctccgactaccggaagaccttctattctacggccctcgcagaaa
gttaatctgccaccaaaacccactcttaaaagcatcaaggtgacgtttcagacaccgatg
cgagacccgcagacgcaaagaattatgacacccagtgttgcaaacaagccagcgaatgca
tttttattggaggattgtacacaagcactggagcagctgcacttgtctgtccccagtaac
tgcgggccaaatccagtagaaacgaataaattggtttccgctaaccaaccggattcagat
gaattgcctatgagcagcacaggggcatatagcattgattttgacaacttggacaacctc
aacccatttaagagtaaaactcaaatgctgaattccccaataaaagctgatcttccaagc
catatggagaatatggaagccaccactcctgtaattccagcaggtgaagcctctaaacac
atggagtcttcaaatacgtctgcagcaaatctagattcccctgttacagttcagttctct
tctgaaagcaacaccgtaggtgtatccgataaatatgcactggatgacacccttcccctc
tcagagtcgggcattaaagatttacaggggtccaataaatcatccaatagcatagaagag
cctgtatcattggataaggacatgtgttcaagtaatgaaaagaacgttgaagctgtaaca
gatgaagccaattctgatgcacaaagctcccctcctgttccaaaatcctcatacagtttt
gacctagatcacattgacatgatcaatccttttaaaaccggaggttccaagcttcagaac
tcaccagcaggagtaaagcaaactcctcctccagaagatgtaaatgtggctaaaactgaa
ccagtaaagcttgagtttaattttagtgatggcgatgcccctgcgagaaaacctcccccc
aaaaaactcggaaagagaccgcccgttaaaactgctaccaagaaaccagttccgaaacag
gaaaccacggcagaaaaacaggaaacgcaaactgcaaagccagtagaagatgaagtcgtt
gttccaaaggcatcatacgagtttgactgggagaagtttgatgatccaaattttaatcca
tttggatgtggtgggtcaaaggtctccagctctcccaagggccagaaggtcgcaaatgaa
gtgcaagctgcttgcaaaccaaaagcagaagacactgacttgacaccagctgagaatgct
gatgggaagaaggaccttggagaaatagagcctgcccaggattctggtgttgctgaagat
aaatcacacacggaagatcaaccagtggttttaagtaatgctgacctgccacatgagcaa
actactgagagttctccggtggaaaatgagacccaaccagaaatttgtacagtcagagat
gaacctttccaaaaggaagtggaccatagaagtccagacattacccctccagaaataaat
ggaacagattcggagtttaaattagccacagaagcagactttttaccagctgcagatatg
gactttaaaccagcttcagaaattttctctgaaggatttggtcatcccattgaaattgac
tatctagagaattttggctccaattcatttaaggagtcggcactcaggaagcagtctctg
tatctgaaattcgatcccttgttaagggagtctccaaagaaaaatgctgcaggcaacagc
ttgcttcccagtgttcccctgaagagcagtttcgagctctttggaggaatatcagaggtt
aatttcccacttatcccatcttttgaaaatgaggaaaaaccgaaaggactggatcttttg
gggactttcacagttgcggacgctgctcctttaattgttgatgctcccagcagtgtggct
gttccagatcctttccttttaacttctgatgccatcgttgaggtgctgaagtacagccag
aaagatatggatgcagcaatagaagcagttcggttagaggttcaagaaaaggatttagaa
gtactggagtggaaaaacagacatgaaaagctttatcttgaatatgtcgaaatggggaaa
ataattgcagagtttgaaggcaccatcacacaaatgctagaggactcgcaaaggcagaaa
gaaatgtccaaactagaaatcaataaagtgttgcaagaaaagcagcaagtgcaggtggat
ctcaactccatggaaaagtccttctctgagctctttaagcgactcgagaaacagaaggag
gtgctggaaggatacagaaagaatgaggaggcgctgaaaaaatgtgtagaggactatctg
gcaaggattaaaaaggaagagcagcgctaccaagccctgaaggcacacgcagaggagaaa
ctcaacagagcaaatgaggagattgctcacgtcaggagtaaagcaaaagccgaatcgact
gctctgcaggcaacgctgcgcaaagagcaaatgaagactcagtcactggagcgttccctt
gagcaaaagagtaaagaaaatgatgaactgaccaagatatgcgatgatctcattttaaag
atggagaagatctga

DBGET integrated database retrieval system