KEGG   Xenopus laevis (African clawed frog): 779404Help
Entry
779404            CDS       T01010                                 

Gene name
cycb3
Definition
cyclin B3
Orthology
K05868  
cyclin B
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
FoxO signaling pathway
Cell cycle
p53 signaling pathway
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    779404 (cycb3)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    779404 (cycb3)
   04115 p53 signaling pathway
    779404 (cycb3)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    779404 (cycb3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 419 aa AA seqDB search
MQSLRPSRPVASKLPKLGKPVLAENNQPSKVEINQTKRSPSSPQGGAKKRAAFGDITNAH
KNPQLLQKKKEGKKEGQKVAIKKTKNAPTSDVTKNNELNIKKTQKKVIVTEEPLPEVKEE
KLSNEERKSVPAKEIPAEKVLPPGVEDIDQDSLDDPFSNSEYAVDIFSYMRDREEKFLLP
NYMEMQTDISKDMRAILVDWIVEVQENFELNHETLYLAVKLVDHYLAVSVIMREKLQLIG
STAVLIASKFEERCPPCVDDILYICDDAYKRDEVVAMEMEILQKLNFDINIPVPYRFLRR
FAKCAHATMETLTLARYICELTLQEYDFVQESASKVAASCLLLALQMKGLGGWTDTLLHY
SGYQTKDLWPLVKRLNFLITYPANETLKAVKDKYSHRVFFEVAKLPPLDMQRLAEPLQS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcaatctcttcgcccatctcgcccagtggcttccaaactcccaaaactggggaagccg
gttcttgcagaaaataatcaacccagcaaggtggagatcaatcagacgaagcgttctcct
tcctctccacagggaggtgcaaagaagagagcagcatttggggacattaccaatgctcac
aaaaacccacagttacttcagaagaagaaggagggaaagaaagagggacagaaagttgcc
atcaagaagactaaaaatgcccccacaagtgatgttactaagaataatgagctgaatatc
aaaaagactcagaagaaggtaatagtaactgaagagcccctccctgaagtaaaagaagag
aaattaagcaatgaggagagaaaatctgtgcctgccaaggaaatacctgctgagaaggtt
cttccaccaggtgttgaggatatagaccaggactctcttgacgacccattttcgaactca
gaatatgcagtggatattttcagctatatgcgggacagagaggagaagtttctgcttccc
aactacatggaaatgcaaacagatattagcaaggacatgagggccatccttgtggattgg
attgtggaggttcaggagaactttgagctaaaccacgaaaccctatacttggcagtgaaa
ctggtggaccattatttagcagtgtctgtcatcatgcgggagaagctccagctcattggt
tcaactgccgtgctcattgcatccaagtttgaggagcgttgcccaccctgtgttgatgat
atcctgtacatctgtgatgatgcatacaaaagggatgaagttgttgctatggagatggaa
atcctgcaaaaacttaactttgacatcaacatcccagtcccataccgcttcctgcgaaga
tttgctaagtgtgcccatgccactatggagactctgacgcttgccaggtacatttgtgaa
ctcacgctacaggaatatgactttgtgcaggagagtgcatctaaggtggctgccagctgc
cttctgcttgctctgcaaatgaaggggttgggtggatggactgacacattactgcattac
agtgggtatcagaccaaggatttatggcccctagtaaagaggctgaatttcctgatcaca
tatccagccaacgagacgttaaaggcagtgaaggacaagtattcacacagggtcttcttt
gaagtggcaaaattgcctcccttggacatgcaaagattagcagagccccttcagagctaa

DBGET integrated database retrieval system