KEGG   Xenopus laevis (African clawed frog): 779438Help
Entry
779438            CDS       T01010                                 

Gene name
gnai2.S, Gi2, gip, gnai2, gnai2b, gnai3
Definition
(RefSeq) guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 S homeolog
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04261  Adrenergic signaling in cardiomyocytes
xla04371  Apelin signaling pathway
xla04540  Gap junction
xla04914  Progesterone-mediated oocyte maturation
xla04916  Melanogenesis
Module
xla_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    779438 (gnai2.S)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    779438 (gnai2.S)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    779438 (gnai2.S)
   04916 Melanogenesis
    779438 (gnai2.S)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    779438 (gnai2.S)
Exosome [BR:xla04147]
 Exosomal proteins
  Proteins found in most exosomes
   779438 (gnai2.S)
GTP-binding proteins [BR:xla04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    779438 (gnai2.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc AAA_16 AAA_29 FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 779438
NCBI-ProteinID: NP_001090525
Xenbase: XB-GENE-6050865
UniProt: Q5U4X0
Position
4S
AA seq 355 aa AA seqDB search
MGCTSSAEDKAAAERSKIIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECRQYRAVVFSNTIQSIMAIIKAMGNLKIDFGDSARADDARQLFALSSTAEEQGIL
PEDLAGVIRRLWADPGVQACFNRSREYQLNDSAAYYLNDLERIARSDYVPTQQDVLRTRV
KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKITRSPLNICFPEYSGANQYDEA
ASYIQTKFEDLNKRRDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcacctcgagcgccgaagacaaagcggcggcagagagatcgaaaataatcgat
aaaaacctgagggaggatggagagaaggcggccagggaggtgaaactgctgctgctgggt
gctggtgaatctgggaagagcacgattgtcaagcagatgaagatcattcatgaggatggg
tattctgaagaagagtgtcgccagtatcgggccgtggtcttcagcaacaccattcagtcc
attatggcaattattaaggctatgggcaacctgaagatagactttggagactctgccagg
gcggacgatgcaagacagttatttgctctctccagcactgcagaagaacagggtatactc
ccggaagacctggctggggttattcgcagactctgggccgacccaggggtgcaggcctgc
tttaaccgatcccgagaataccagctcaatgattccgctgcatattatctcaatgatctg
gagcgcattgctcggtctgattacgttcccactcagcaagatgttttgagaacacgtgtg
aaaactactgggattgtggagacccacttcaccttcaaagacctgcacttcaaaatgttt
gatgtcgggggacagcgatctgagcgaaagaaatggatccactgctttgagggagtgact
gcaattattttttgcgtggcactcagtgcctacgacctggtgttggcagaggatgaggag
atgaatcggatgcacgagagcatgaaattatttgacagtatctgtaacaacaaatggttc
actgagacttccatcatcctcttcctcaacaaaaaggatctctttgaggagaagatcacc
cgcagccctctcaatatctgcttccctgagtactctggtgccaatcagtacgatgaggct
gctagttacatccagactaaatttgaggatttaaacaaaaggcgtgacacaaaggagata
tatacacatttcacatgtgccaccgacacgaaaaacgtacagtttgtgtttgatgctgtg
acggacgttatcatcaagaataacctgaaagactgtggccttttctaa

DBGET integrated database retrieval system