KEGG   Xiphophorus maculatus (southern platyfish): 102216696Help
Entry
102216696         CDS       T02923                                 

Definition
protein-glutamine gamma-glutamyltransferase K-like
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102216696
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 808 aa AA seqDB search
MRQESISHKFSTFGRVARMPPVIHSVRDSSAVGRFPTVTLPFVEDVEADKEEPAENDVNE
ESACRRWLRKACPCCYKRPGGDDDDVAETVVTGVDDPDKEEGANGEKPTAEEGNLNELLL
NVRSIDLMKSKTGENLVEHHTNLYQSDKFVIRRGQSFQMWITLSRPFDPHTDKLHLELKT
GPLPALSNGTHVIVPLVEDLEDGRWEAAVVKRDDRRLKLSVNSPPTAVIGRYQLTVETSC
ANGQATSRHDPADDIYMLFNPWCEGDSVFLDSEEERQEFVLNDVGRIYYGTHLQIGDRTW
DYGQFNNGTLAACLFVLDRSQTPNSGWGDPVNVTRIISAMINSPDDLGVLEGNWSGDYSR
GTPPTVWSGSVEILQQYYESRGTPVRYGQCWVFAGVFTTVLRCLGIPARTVTNFSSAHDT
DVSLTTDIYLDEEMEPIEYLNADSIWNFHVWTDCWMSRPDLPPGNGGWQTVDATPQETSQ
GMFRCGPASLSAIRNGQVYLKHDCAFVFAEVNSDKIYWQKNKDGTFSQFCSEKNTVGLSI
STKAVGSDEREDITHLYKHPEGSEEERIAVETACSYGSKAAAYSSPTAEDVSLEVIMEGD
GPRMGEDAELTIRLRNVSSEPRTITLHSQLAVMYYTGVHKDTVKKDKVDEEILPNEVNDL
TWELKYDMYKNQLIDHSALMLTLSARVRETQQVLATQFSFRLRTPDLVIKPVGKAVVGQK
MKVEISFTNPLPLVLKAVIFHLEGTGLLPGKKIHYGDIGGHASVSFVEDFVPTLPGPRKL
LASLDCRQLTQVHGVSDIAVEDKSSVAS
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgcggcaggagtcgatctcccacaaattctccactttcggacgtgtggcaaggatgcca
ccagtgattcactcagtcagagacagctctgccgtcggtcggttcccaactgtcactttg
ccgtttgtggaggacgtggaggcggacaaagaggaaccggcagagaatgacgttaacgag
gagagcgcctgccgacggtggctgcgcaaggcgtgtccgtgctgttataaacggccaggc
ggcgacgacgacgacgttgcggagaccgtggtcaccggggtggatgatccagataaagag
gagggggcaaatggagagaagccaaccgctgaggaaggcaatctaaatgaacttcttctg
aacgtccgatcgatagatctgatgaaaagcaaaacgggagagaacctggtggagcatcac
accaacctctaccagagcgacaagttcgtcatccgcagagggcagagcttccagatgtgg
ataaccttatctcgaccttttgacccccacacagacaagcttcatctggagctgaaaaca
ggtcccctccctgcgttgtcgaacggaacccatgtcatcgtccctctggtggaggacctg
gaggacggtcgctgggaggccgcggtcgtcaagcgggacgacaggaggttaaagctgtct
gtgaattcgcctcccacggctgtcataggcaggtaccagctcaccgtggaaacaagctgc
gccaacggccaggccacctccagacacgaccctgccgatgacatctacatgctgttcaac
ccctggtgtgaaggcgactctgttttcctggactccgaggaggagcggcaggagttcgtc
ctcaatgatgttggtcggatctactacggcacacacctccagatcggagacaggacgtgg
gactacggccagtttaacaacgggaccctcgccgcttgcctcttcgtgttggatcggagt
caaaccccaaactccggttggggcgacccagtcaatgtgacgcggatcatctcagccatg
ataaactctcccgacgacctcggtgttttggaaggaaactggtcaggagactattcacgg
ggaactccccccaccgtgtggagtggaagtgtggaaatcctgcagcaatactacgaaagc
aggggaacgcccgttaggtacggccagtgctgggtctttgctggcgtcttcactacagtg
ttgcgttgtctaggcattcctgctcgaacggtgaccaactttagctcggcgcacgatacc
gacgtttccttgacgactgacatctacctggacgaggaaatggagccgatagaatacctt
aatgcagactctatctggaacttccacgtgtggaccgactgctggatgtctcgtccagac
ttgcctcctggcaacggaggctggcaaaccgtcgacgccacgccgcaggaaaccagtcag
ggcatgtttcgctgtggcccggcttccctcagcgcgatccgtaatggtcaggtctacctc
aaacacgactgcgcctttgtgtttgccgaggtgaatagtgataaaatatactggcagaag
aacaaagatggcaccttcagtcagttctgcagtgagaagaacactgtgggtctctccatc
agcaccaaggccgtgggctcagacgaacgggaggatatcacacacctttacaaacaccca
gaaggctcagaggaggaacgtattgccgtggaaactgcctgtagctacggctccaaagcg
gccgcctactcgtctccgacggcggaagacgtctctttggaagtgatcatggagggcgac
ggtcccagaatgggggaggatgcagagctgaccatcaggctgaggaacgtcagctcggag
ccgcgcaccattacgttgcacagccagttagccgtcatgtactacaccggagtccacaaa
gacacggtgaaaaaggacaaagtagacgaggaaattctgcccaacgaggtgaacgatttg
acttgggaattgaagtacgacatgtacaagaaccagctgatagatcattcagccctgatg
ctaacgctttccgccagggtcagagaaacgcagcaagtcctggcgacccagttcagcttc
cgactcaggacgccagacctcgttataaagccggtggggaaggctgtggtggggcagaag
atgaaagtggagatttctttcacaaaccctctaccgctggtgctgaaagcagtgatattt
cacctggaaggaacaggcctcctacctgggaaaaagatccactatggagatatcggcgga
catgcctccgtctccttcgtggaggacttcgtccccacccttcccggaccgaggaaatta
ctggcttctctggactgcaggcagctcacacaggtccacggcgtgagcgacatcgccgtg
gaggacaaaagcagcgtggcttcgtag

DBGET integrated database retrieval system