KEGG   Xiphophorus maculatus (southern platyfish): 102217274Help
Entry
102217274         CDS       T02923                                 

Definition
(RefSeq) glycogen [starch] synthase, liver
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102217274
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102217274
Enzymes [BR:xma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102217274
Glycosyltransferases [BR:xma01003]
 Polysaccharide
  Storage polysaccharide
   102217274
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
17
AA seq 483 aa AA seqDB search
MPLSRSLSITSLSGLLPAWEDDELPVEDLMLFEVAWEVTNKVGGIYTVIQSKAKVTVDEW
GENYYMMGPYFEHNFKTQVEGCVPPNPLIQKAMDALINNGCQVHFGRWLIEGSPYVILFD
IGSAAWNLDRWKGDLWETCHIGLPYHDREANDSLILGSLIAWFFKELTDHLGDKPNVISH
FHEWQAGPGLILSRSRNIPMATVFTTHATLLGRYLCAGNVDFYNNLDKFNIDKEAGERQI
YHRYCLERAAVHCAHVFTTVSQITAVEAKHMLHRKPDVVTPNGLNVKKFSAMHEFQNLHS
TNKTRIQEFVRGHFYGHLDFNLDKTLFFFIAGRYEFSNKGADIFLESLSRLNYLLRVHRN
DLTVVVFFIMPAKTNNFNVESLKGQAVRKQLWDTAHTVKERFGKKLYESLLTGNIPDMNT
ILDRDDLTIMKRAIYATQRHSLPPVTTHNMLDDSEDPILFNVRRIGLFNSRNDRVKFIVP
VAT
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgccattgtcacgttccctgtccattacatccctgagtgggctgttaccagcctgggag
gacgatgagctgccggtggaagacctgatgctttttgaagtggcatgggaggtcaccaac
aaagttggaggaatttacactgtcatccagtctaaagctaaggtcacagtggatgaatgg
ggagagaactattacatgatgggaccatactttgaacacaacttcaagacacaagtggaa
ggctgtgtaccacccaacccactgatccagaaggcaatggatgctcttatcaacaatgga
tgccaggttcattttggtcgctggctgattgagggcagcccttatgttatcctgtttgac
atcggctcagcagcctggaacctggaccgatggaagggggacctgtgggagacctgccac
attggtcttccgtatcacgaccgagaggctaatgactctctcattctgggctccttgatt
gcctggttctttaaagagctaacagaccaccttggagacaaacccaatgtcatcagtcac
ttccatgagtggcaggcaggtcctgggcttattctctctcgctcccgtaacattcctatg
gcaacagtttttactactcatgccacactgcttggaagatatctttgtgctgggaatgtt
gacttttacaacaacttggataagttcaatattgacaaggaggcaggagagaggcagatc
taccatcggtactgcctggagcgagcagcggtgcattgcgctcacgtcttcaccacagtg
tcccagatcacagcagtggaggccaaacacatgttgcacaggaagccagatgtggtgact
ccaaatgggctgaatgtgaaaaaattctcagccatgcatgagtttcagaacttgcactcc
actaacaagactcgcatccaggagtttgttagaggacacttttatggacatcttgacttc
aacttggacaaaaccctgttctttttcattgctgggagatatgaattctccaacaaagga
gccgacatttttcttgaatcgctgtctagactcaactacttgctgcgggtccacagaaat
gacttgactgtggtggttttcttcataatgccagccaaaacaaacaacttcaatgtggag
tcactgaaggggcaggcagtgcgcaaacagctctgggacacggctcacacggtgaaggag
aggtttggtaaaaagctttatgaatctttgctgacaggaaacatcccagacatgaacacc
attctggacagagatgacttgacgattatgaagagagctatttatgctacacagaggcac
agtcttcctccagtgaccactcacaatatgctggacgactctgaagatccaatcctgttc
aacgtcagacgcatcggtctcttcaattccagaaacgaccgagtcaagttcatcgttcca
gttgctacctga

DBGET integrated database retrieval system