KEGG   Xiphophorus maculatus (southern platyfish): 102217274Help
Entry
102217274         CDS       T02923                                 

Gene name
gys2
Definition
(RefSeq) glycogen synthase 2 (liver)
  KO
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Starch and sucrose metabolism
Insulin signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102217274 (gys2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102217274 (gys2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    102217274 (gys2)
Enzymes [BR:xma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102217274 (gys2)
Glycosyltransferases [BR:xma01003]
 Polysaccharide
  Storage polysaccharide
   102217274 (gys2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 704 aa AA seqDB search
MPLSRSLSITSLSGLLPAWEDDELPVEDLMLFEVAWEVTNKVGGIYTVIQSKAKVTVDEW
GENYYMMGPYFEHNFKTQVEGCVPPNPLIQKAMDALINNGCQVHFGRWLIEGSPYVILFD
IGSAAWNLDRWKGDLWETCHIGLPYHDREANDSLILGSLIAWFFKELTDHLGDKPNVISH
FHEWQAGPGLILSRSRNIPMATVFTTHATLLGRYLCAGNVDFYNNLDKFNIDKEAGERQI
YHRYCLERAAVHCAHVFTTVSQITAVEAKHMLHRKPDVVTPNGLNVKKFSAMHEFQNLHS
TNKTRIQEFVRGHFYGHLDFNLDKTLFFFIAGRYEFSNKGADIFLESLSRLNYLLRVHRN
DLTVVVFFIMPAKTNNFNVESLKGQAVRKQLWDTAHTVKERFGKKLYESLLTGNIPDMNT
ILDRDDLTIMKRAIYATQRHSLPPVTTHNMLDDSEDPILFNVRRIGLFNSRNDRVKIIFH
PEFLSSTSPLLPMDYEDFVRGCNLGVFPSYYEPWGYTPGECTVMGIPSVTTNLSGFGCFM
EEHVSDPAAYGIYIVDRRFKSAEESCNQLTQFMFSFCQQSRRQRIIQRNRTERLSDLLDW
RYLGRFYTHARHLALSRSFPDKYKIDNKGPLKTEGFRYPRPASVPPSPSASLHSTPHHSD
VEDDDDEPYNEEEEAERDRLNIKAPFKLGSVPEGKKKQPGESGN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgccattgtcacgttccctgtccattacatccctgagtgggctgttaccagcctgggag
gacgatgagctgccggtggaagacctgatgctttttgaagtggcatgggaggtcaccaac
aaagttggaggaatttacactgtcatccagtctaaagctaaggtcacagtggatgaatgg
ggagagaactattacatgatgggaccatactttgaacacaacttcaagacacaagtggaa
ggctgtgtaccacccaacccactgatccagaaggcaatggatgctcttatcaacaatgga
tgccaggttcattttggtcgctggctgattgagggcagcccttatgttatcctgtttgac
atcggctcagcagcctggaacctggaccgatggaagggggacctgtgggagacctgccac
attggtcttccgtatcacgaccgagaggctaatgactctctcattctgggctccttgatt
gcctggttctttaaagagctaacagaccaccttggagacaaacccaatgtcatcagtcac
ttccatgagtggcaggcaggtcctgggcttattctctctcgctcccgtaacattcctatg
gcaacagtttttactactcatgccacactgcttggaagatatctttgtgctgggaatgtt
gacttttacaacaacttggataagttcaatattgacaaggaggcaggagagaggcagatc
taccatcggtactgcctggagcgagcagcggtgcattgcgctcacgtcttcaccacagtg
tcccagatcacagcagtggaggccaaacacatgttgcacaggaagccagatgtggtgact
ccaaatgggctgaatgtgaaaaaattctcagccatgcatgagtttcagaacttgcactcc
actaacaagactcgcatccaggagtttgttagaggacacttttatggacatcttgacttc
aacttggacaaaaccctgttctttttcattgctgggagatatgaattctccaacaaagga
gccgacatttttcttgaatcgctgtctagactcaactacttgctgcgggtccacagaaat
gacttgactgtggtggttttcttcataatgccagccaaaacaaacaacttcaatgtggag
tcactgaaggggcaggcagtgcgcaaacagctctgggacacggctcacacggtgaaggag
aggtttggtaaaaagctttatgaatctttgctgacaggaaacatcccagacatgaacacc
attctggacagagatgacttgacgattatgaagagagctatttatgctacacagaggcac
agtcttcctccagtgaccactcacaatatgctggacgactctgaagatccaatcctgttc
aacgtcagacgcatcggtctcttcaattccagaaacgaccgagtcaagatcatcttccat
cctgagttcttgtcctccaccagccctctgctgccaatggattatgaggactttgtccga
ggctgtaaccttggagttttcccttcctactatgagccgtggggatacacaccaggtgag
tgtactgtgatgggcataccaagtgtcacaaccaatctgtcagggtttggctgttttatg
gaggagcatgtctcagaccctgctgcctatggtatctacattgtggaccgtcggttcaaa
tctgctgaggaatcctgcaaccagctgacccagttcatgttcagtttctgtcagcagtct
cgacgtcagcgcatcatccagaggaacagaaccgagaggctgtcagacctgctggactgg
agatacttaggaaggttctacacacacgcccgtcatctggcacttagcagaagtttccca
gacaagtacaagattgataacaaaggccctctaaagactgagggtttccgttatcctcgg
ccagcttcagtgcctccgtctccctctgcctccctccattccaccccgcaccacagtgat
gtagaggatgatgatgatgagccatacaatgaagaagaggaggcagagcgggaccgtttg
aacatcaaggctccttttaagctgggatcagtgccagaaggcaagaaaaagcagccagga
gagtcagggaattaa

DBGET integrated database retrieval system