KEGG   Xiphophorus maculatus (southern platyfish): 102217393Help
Entry
102217393         CDS       T02923                                 

Definition
UDP-glucuronosyltransferase-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102217393
   00053 Ascorbate and aldarate metabolism
    102217393
   00500 Starch and sucrose metabolism
    102217393
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102217393
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102217393
   00860 Porphyrin and chlorophyll metabolism
    102217393
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102217393
   00982 Drug metabolism - cytochrome P450
    102217393
   00983 Drug metabolism - other enzymes
    102217393
Enzymes [BR:xma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102217393
Glycosyltransferases [BR:xma01003]
 Others
  Hydrophobic molecule
   102217393
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 527 aa AA seqDB search
MRSRVWFPLTGLLAWLCCLRLGPVQGEKVLVMPVDGSHWLSMKILVKELGRRGHEVTVLV
PESSLLIQGSDSYKTEVYKVPYTQDELDKSLNKLREGLFDQQPGLADLFVNVNRLVQFTS
IQSVGCEALLDNEPLMTKLRTEGFDMMLTDPFLPCGSILARMFSIPAVYFLRGLPCELDI
KANKCPSPVSYVPKFFSGNTDRMSFPERVKNMMMSFLESYICTVLYQKFDELVSKRIQDG
MSYKELISEGAIWLLRYDFVFDWPKPLMPNMVLIGGINCAKTAPLPADLKEFVDASGDDG
FIVFTLGSMVSDMPEAKAKQFFDAFRQIPQRVIWRYTGEIPKDVPKNVKLMKWVPQNDLL
AHPKAKVFMTHGGSHGIYEGVCNGVPMLMFPLFGDQGDNVHRMTSRGVAVKLNIFDMTTE
TLVDGLKKVIYDKGYKERMVGLSQIHLDRPVEPLDLAVFWSEFVMRHKGASHLRVAAHDL
NWFQYHSLDVIGFLVFVFVAVLWLTLKSCLFCTRKCCGKRGAKKKSE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgagaagcagagtgtggtttcctctaacggggctgttggcctggctatgctgccttcgt
ctcgggcccgttcagggggagaaggtgctggttatgccggtggatggcagccactggctc
agcatgaagattctggtgaaggagctcggccgcagaggccacgaggtcacggtcctggtg
cctgaaagcagcctgttgatccaaggttctgacagctacaagacggaggtctacaaagtg
ccgtatactcaagatgaactggataagagcttaaacaagctcagggaaggactgtttgac
cagcagccaggattagcagatttatttgtgaatgtgaaccgtttggtgcagtttacgtct
atacaatcggtgggctgtgaggctttactggacaatgagcctttgatgactaaactcagg
acggagggatttgacatgatgcttacagaccctttccttccttgtggctctatcctagca
cgtatgttttccattcctgctgtgtattttctgcgtgggcttccctgtgagctggatatt
aaagctaacaagtgtccctctcctgtttcctacgttcctaagtttttctctggtaacaca
gaccgcatgagcttcccagagagggttaaaaacatgatgatgtcttttttggagtcgtac
atatgcacggtcctgtaccagaaatttgatgagctggttagcaagcgcatccaagacggc
atgtcgtacaaagaactaataagtgaaggagctatctggctcctcagatatgactttgtt
tttgactggcccaaacctctcatgccaaacatggttttaataggtgggatcaactgtgca
aagacggctcctcttccagcagacctgaaggaatttgtggatgcttcaggagacgatggc
ttcattgtctttacgctgggctcaatggtgtccgacatgcctgaagctaaagccaagcag
ttctttgacgctttccgacaaattcctcagagggtgatttggaggtacacaggtgaaata
cccaaagatgtacccaagaacgtcaaacttatgaaatgggtacctcagaacgatcttcta
gctcaccccaaagctaaagtcttcatgactcatggtggaagtcatggcatctatgaaggc
gtctgcaatggcgttcccatgttgatgtttccactcttcggggatcagggagacaacgtg
caccgaatgacgtcgcgcggtgttgctgtgaagctcaatatatttgatatgacaacagaa
acattggtagatggactgaaaaaagttatctatgacaaaggatacaaagagcgcatggtg
gggctgtctcagatacacctggaccgccctgttgagcctttggacctggctgttttctgg
tctgagtttgtaatgagacacaagggagcatcacatctaagggtggctgcacatgacctg
aactggtttcagtaccacagcctggatgttatcggctttttagtttttgtttttgtcgcc
gttttgtggttgactctgaaatcctgtttgttttgcactcgcaagtgttgcggcaagaga
ggtgcaaagaaaaaatctgagtag

DBGET integrated database retrieval system