KEGG   Xiphophorus maculatus (southern platyfish): 102217411Help
Entry
102217411         CDS       T02923                                 

Gene name
pomt2
Definition
(RefSeq) protein-O-mannosyltransferase 2
  KO
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    102217411 (pomt2)
Enzymes [BR:xma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     102217411 (pomt2)
Glycosyltransferases [BR:xma01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   102217411 (pomt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 755 aa AA seqDB search
MEKEECISQWHKTRDSSTLRNRKVFPSPEQTHQSPITPESKIKQDDSPCSNGSSGDFSAR
ASVDSPNQLLLIVVTGLSFATRLYKITEPPHVCWDETHFGKMGSYYINRTFFFDVHPPLG
KMLIALAGYMTGYDGTFPFVKPGDKYEDHNYWGMRGFCAILGSFLPIFAYLIVQELSRSH
TAALITAALLIFDTGCITISQYILLDPILMFFIMAAVLSMIKFNQQSSRPFTAPWWLWLV
LCGAALAGALGVKFVGLFVILLVGLNTAGELWRILGDLSLSLMDVAKHFLARVVGLILLP
LFLYVAVFAVHFALLNKSGPGDGFFSSTFQSRLIGNNLYNVSMPEYLAYGSTITVKNLRI
AGGYLHSHWHLYPEGVGAKQQQVTAYLHKDYNNMWLVQKPDNDTQSEIPDLVRHGDIIRL
EHKETTRNLHSHLHQAPLTKKHFQVTGYGINGTGDTNDLWQVEVCGGRRGDLVKVLRSKV
RFLHKATGCVLYSSGKTLPKWGWEQVEVTCSPYLKETPSSQWNIEDHINPRLPNISLSLL
KPNFLEILLESHIVMIRGNSGLKPKDNEMNSKPWHWPINYQGLRFSGVNETEYRVYLLGN
PVVWWINLASLGLYLIMVAVSSIAIQRGISLQQERLEHSEVLTGGGGLLLLGWLLHYAPF
YIMGRVLYYHHYFPAMLFSSMLTGVTLDTLLRNADLLLCQPYSDWLQRGGQMILLFTVLY
SFYMFHPLSYGMTGPLAHEPGSAMAGLKWMDSWEF
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagaagaatgtatttctcagtggcacaaaacgagggacagttcaacattacga
aaccggaaggtcttcccatctccagagcagacccatcaatctccaatcactccagaatca
aagatcaaacaagatgacagcccctgctcaaatggatcatctggtgatttttcagccaga
gcaagtgttgattccccaaaccaattgcttctcattgtagtaacaggactatctttcgct
acacggctctataagataacagaaccccctcatgtgtgttgggatgagactcactttgga
aaaatgggaagctactacatcaacagaactttcttttttgatgtgcatcctcctcttgga
aagatgctgattgctcttgctggttatatgactggctatgatggcacctttccttttgta
aagccgggagacaaatatgaagaccacaactactggggaatgagagggttttgcgccata
ttggggtccttcctgccaatctttgcttacctcattgtgcaggagctgtctcgttctcac
actgctgctctcatcacagccgccctgctcatatttgacacaggctgcatcaccatctct
cagtacatcctgttagatcccatcctcatgtttttcatcatggctgccgtgctcagtatg
atcaagttcaaccagcagagctccaggccttttactgccccctggtggctgtggctcgta
ctgtgcggtgctgctcttgctggtgctctcggggtgaagtttgtgggtctgtttgttatc
ctcctggtgggcctgaacacagctggagaactctggaggattttaggcgacctgagtctc
tcactgatggatgttgcaaagcacttcctggcccgtgttgtcggccttatcttgcttcca
ctattcctatatgtggcagtatttgcagttcactttgctctgttgaataaaagtgggcca
ggcgatggtttctttagttcgactttccagtcgcgtctcattgggaacaacctgtacaac
gtgtccatgccagagtatctggcatatggctccaccattactgtgaaaaatctccgtatt
gctggaggttatctgcactcccactggcacttataccccgagggagttggggcgaagcag
cagcaggtgacagcttacctccacaaagactacaacaacatgtggctggttcaaaaacca
gataatgacactcagtcagagattcctgatttggttcgtcatggtgacatcattcggcta
gagcacaaagaaacaacccgtaaccttcacagccacctccatcaagctcctctgaccaag
aagcacttccaagttacaggttatggaattaacggaacaggtgacactaacgacctgtgg
caagtggaggtttgtggaggccggaggggcgacctggtgaaggtgctgcgcagcaaagtt
cgctttctgcacaaagccacgggctgcgtgctgtattcatctggcaagactcttccgaag
tggggctgggagcaggtggaggtgacctgcagtccgtacctgaaggagactccaagctct
cagtggaacatcgaggatcacatcaatcccagattacccaacattagcctttcactactg
aagcctaattttctggaaatcttgctggagtctcatatagtcatgataaggggtaatagt
ggcttgaaacctaaagacaatgaaatgaactccaaaccttggcactggcccatcaactac
cagggattgaggttttcaggtgtaaatgagacggaatatcgtgtctacttactggggaac
cctgtggtctggtggataaatctggccagcttggggttgtatctcatcatggtggcagtg
tcatctatagctattcaaagaggaatatcgctgcagcaggaaagattagagcattccgaa
gttctcacgggaggaggtggacttctgctgctcggctggctgctgcactacgcccccttc
tacatcatgggccgtgtcctctactatcatcactactttcctgcaatgctcttcagtagc
atgctgacaggagttacattagacactctgctgagaaatgccgatctgttactatgccaa
ccctattctgattggttgcagagaggagggcagatgatacttttatttactgttctatac
agtttctacatgtttcatccactgtcctacggcatgacgggtcctcttgcacacgagcca
ggcagcgccatggctggccttaagtggatggactcctgggagttttag

DBGET integrated database retrieval system