KEGG   Xiphophorus maculatus (southern platyfish): 102217411Help
Entry
102217411         CDS       T02923                                 

Definition
protein O-mannosyl-transferase 2-like
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    102217411
Enzymes [BR:xma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     102217411
Glycosyltransferases [BR:xma01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   102217411
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 775 aa AA seqDB search
MNDPIVNQDECKEFGSLLCGTWTCKNTIGSYKCFMQCQPDMLSGDCEQTHQSPITPESKI
KQDDSPCSNGSSGDFSARASVDSPNQLLLIVVTGLSFATRLYKITEPPHVCWDETHFGKM
GSYYINRTFFFDVHPPLGKMLIALAGYMTGYDGTFPFVKPGDKYEDHNYWGMRGFCAILG
SFLPIFAYLIVQELSRSHTAALITAALLIFDTGCITISQYILLDPILMFFIMAAVLSMIK
FNQQSSRPFTAPWWLWLVLCGAALAGALGVKFVGLFVILLVGLNTAGELWRILGDLSLSL
MDVAKHFLARVVGLILLPLFLYVAVFAVHFALLNKSGPGDGFFSSTFQSRLIGNNLYNVS
MPEYLAYGSTITVKNLRIAGGYLHSHWHLYPEGVGAKQQQVTAYLHKDYNNMWLVQKPDN
DSKRISEIPDLVRHGDIIRLEHKETTRNLHSHLHQAPLTKKHFQVTGYGINGTGDTNDLW
QVEVCGGRRGDLVKVLRSKVRFLHKATGCVLYSSGKTLPKWGWEQVEVTCSPYLKETPSS
QWNIEDHINPRLPNISLSLLKPNFLEILLESHIVMIRGNSGLKPKDNEMNSKPWHWPINY
QGLRFSGVNETEYRVYLLGNPVVWWINLASLGLYLIMVAVSSIAIQRGISLQQERLEHSE
VLTGGGGLLLLGWLLHYAPFYIMGRVLYYHHYFPAMLFSSMLTGVTLDTLLRNADLLLCQ
PYSDWLQRGGQMILLFTVLYSFYMFHPLSYGMTGPLAHEPGSAMAGLKWMDSWEF
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaccccattgtgaaccaggatgagtgtaaagagtttggaagtttgttgtgtggt
acctggacctgcaagaacaccatcggctcctataagtgcttcatgcagtgccagcctgac
atgcttagcggagactgcgagcagacccatcaatctccaatcactccagaatcaaagatc
aaacaagatgacagcccctgctcaaatggatcatctggtgatttttcagccagagcaagt
gttgattccccaaaccaattgcttctcattgtagtaacaggactatctttcgctacacgg
ctctataagataacagaaccccctcatgtgtgttgggatgagactcactttggaaaaatg
ggaagctactacatcaacagaactttcttttttgatgtgcatcctcctcttggaaagatg
ctgattgctcttgctggttatatgactggctatgatggcacctttccttttgtaaagccg
ggagacaaatatgaagaccacaactactggggaatgagagggttttgcgccatattgggg
tccttcctgccaatctttgcttacctcattgtgcaggagctgtctcgttctcacactgct
gctctcatcacagccgccctgctcatatttgacacaggctgcatcaccatctctcagtac
atcctgttagatcccatcctcatgtttttcatcatggctgccgtgctcagtatgatcaag
ttcaaccagcagagctccaggccttttactgccccctggtggctgtggctcgtactgtgc
ggtgctgctcttgctggtgctctcggggtgaagtttgtgggtctgtttgttatcctcctg
gtgggcctgaacacagctggagaactctggaggattttaggcgacctgagtctctcactg
atggatgttgcaaagcacttcctggcccgtgttgtcggccttatcttgcttccactattc
ctatatgtggcagtatttgcagttcactttgctctgttgaataaaagtgggccaggcgat
ggtttctttagttcgactttccagtcgcgtctcattgggaacaacctgtacaacgtgtcc
atgccagagtatctggcatatggctccaccattactgtgaaaaatctccgtattgctgga
ggttatctgcactcccactggcacttataccccgagggagttggggcgaagcagcagcag
gtgacagcttacctccacaaagactacaacaacatgtggctggttcaaaaaccagataat
gacagtaagagaatttcagagattcctgatttggttcgtcatggtgacatcattcggcta
gagcacaaagaaacaacccgtaaccttcacagccacctccatcaagctcctctgaccaag
aagcacttccaagttacaggttatggaattaacggaacaggtgacactaacgacctgtgg
caagtggaggtttgtggaggccggaggggcgacctggtgaaggtgctgcgcagcaaagtt
cgctttctgcacaaagccacgggctgcgtgctgtattcatctggcaagactcttccgaag
tggggctgggagcaggtggaggtgacctgcagtccgtacctgaaggagactccaagctct
cagtggaacatcgaggatcacatcaatcccagattacccaacattagcctttcactactg
aagcctaattttctggaaatcttgctggagtctcatatagtcatgataaggggtaatagt
ggcttgaaacctaaagacaatgaaatgaactccaaaccttggcactggcccatcaactac
cagggattgaggttttcaggtgtaaatgagacggaatatcgtgtctacttactggggaac
cctgtggtctggtggataaatctggccagcttggggttgtatctcatcatggtggcagtg
tcatctatagctattcaaagaggaatatcgctgcagcaggaaagattagagcattccgaa
gttctcacgggaggaggtggacttctgctgctcggctggctgctgcactacgcccccttc
tacatcatgggccgtgtcctctactatcatcactactttcctgcaatgctcttcagtagc
atgctgacaggagttacattagacactctgctgagaaatgccgatctgttactatgccaa
ccctattctgattggttgcagagaggagggcagatgatacttttatttactgttctatac
agtttctacatgtttcatccactgtcctacggcatgacgggtcctcttgcacacgagcca
ggcagcgccatggctggccttaagtggatggactcctgggagttttag

DBGET integrated database retrieval system