KEGG   Xiphophorus maculatus (southern platyfish): 102218159Help
Entry
102218159         CDS       T02923                                 

Definition
(RefSeq) erythroblast NAD(P)(+)--arginine ADP-ribosyltransferase-like
Organism
xma  Xiphophorus maculatus (southern platyfish)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 269 aa AA seqDB search
MKAKMFLIGSLWLSLCCLLRVQPKKASFLSIGDPLDMAVNSVDDRYSTCATQMEAKVKKT
YFEKEMENSVFSKAWKGAESCADRNMKQKEAADEALTKDHMQAICVYTAGGQADFYKAFN
DAVKTNRQQYSSSFPFHSLHFWLTRAIQILKPNYNECYTTFRRMKSTLTGEVNQEIRFGN
FASSSKLTTLTSFGNTTCFNITTCHGAYLKKYPKLKDHEQEVLIPPYETFKIVSKAKPQE
LNDCKTVYVLKDNGVESNLDCHVANQIIL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccaaaatgttcctgattggttctctgtggttgtctctttgctgcctgcttcgt
gttcaaccaaagaaggcaagttttctttctattggtgatccgctggacatggctgtgaac
tctgttgatgacaggtactctacctgtgctacacagatggaggcaaaggtcaaaaagacg
tattttgaaaaggaaatggaaaatagtgtattcagcaaggcatggaagggagcagaaagt
tgtgcagatagaaatatgaaacaaaaagaagcagcagatgaggctctaacaaaagatcac
atgcaagcaatttgtgtttacacagctggagggcaagcagatttctataaggcattcaat
gacgcagtcaagaccaacagacaacaatatagttcatcctttccattccactctttgcat
ttctggctgaccagagcgatacagatcctcaaacccaattataatgaatgttacacaact
ttccgtagaatgaaatccacattaactggtgaagtcaaccaagaaattcgatttggtaat
tttgcctcctcctccaaattaacaactctgacaagctttggtaatacaacatgctttaac
attacaacctgtcatggagcttatctgaaaaaatacccaaagctcaaagatcatgagcag
gaggtgctcattccaccttatgagacgttcaagatagtcagcaaagctaaacctcaagaa
cttaatgactgtaagactgtctatgttctgaaagataatggtgttgaaagcaatcttgac
tgccatgttgcaaaccaaataattttgtga

DBGET integrated database retrieval system