KEGG   Xiphophorus maculatus (southern platyfish): 102218159Help
Entry
102218159         CDS       T02923                                 

Definition
erythroblast NAD(P)(+)--arginine ADP-ribosyltransferase-like
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102218159
Cellular antigens [BR:xma04090]
 Proteins
  102218159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 238 aa AA seqDB search
MKAKMFLIGSLWLSLCCLLRVQPKKIGDPLDMAVNSVDDRYSTCATQMEAKVKKTYFEKE
MENSVFSKAWKGAESCADRNMKQKEAADEALTKDHMQAICVYTAGGQADFYKAFNDAVKT
NRQQYSSSFPFHSLHFWLTRAIQILKPNYNECYTTFRRMKSTLTGEVNQEIRFGNFASSS
KLTTLTSFGNTTCFNITTCHGAYLKKYPKLKDHEQEVLIPPYETFKIVSKAKPQELND
NT seq 715 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccaaaatgttcctgattggttctctgtggttgtctctttgctgcctgcttcgt
gttcaaccaaagaagattggtgatccgctggacatggctgtgaactctgttgatgacagg
tactctacctgtgctacacagatggaggcaaaggtcaaaaagacgtattttgaaaaggaa
atggaaaatagtgtattcagcaaggcatggaagggagcagaaagttgtgcagatagaaat
atgaaacaaaaagaagcagcagatgaggctctaacaaaagatcacatgcaagcaatttgt
gtttacacagctggagggcaagcagatttctataaggcattcaatgacgcagtcaagacc
aacagacaacaatatagttcatcctttccattccactctttgcatttctggctgaccaga
gcgatacagatcctcaaacccaattataatgaatgttacacaactttccgtagaatgaaa
tccacattaactggtgaagtcaaccaagaaattcgatttggtaattttgcctcctcctcc
aaattaacaactctgacaagctttggtaatacaacatgctttaacattacaacctgtcat
ggagcttatctgaaaaaatacccaaagctcaaagatcatgagcaggaggtgctcattcca
ccttatgagacgttcaagatagtcagcaaagctaaacctcaagaacttaatgact

DBGET integrated database retrieval system