KEGG   Xiphophorus maculatus (southern platyfish): 102218690Help
Entry
102218690         CDS       T02923                                 

Definition
dopamine beta-hydroxylase-like
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:xma00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 614 aa AA seqDB search
MRIFSKDVRLQDITIMYFTGLAALMVILVASYQAPSNAIDVSSLKPSPSSSLPPLPMPFH
MPLDPLGNLQLAWNISYATQEIYIQLRVAELRHGVVLGMSDRGELTNADLVVLWDNGTRS
YFGDAWSDSKGHVSLDSHQDYELIEAKQKADGFYLLFKRPFSTCDPRDYVIEEGTVHIIY
GLLDQPLASLGDLNLSRIHMGVQRVLMLRPDMLSPTLPPDVKTMDVLAPNVIIPNQETTY
WCFIQKLSDDMPKNHIVMYESVITPGNEAIVHHIEVFECAPDLREVPQYSGSCDDKMKPK
KLNFCRHVLAAWAMGAEAFYYPPDAGLAIGGPGSSRFLRLEVHYHNPLLISGRHDSSGIR
LHYTPNLRRYDAGIMELGLVYTPVMAIPPKQHTFYLTGYCTSKCTRTALPPGGIYVFASQ
LHTHLAGRGVRTVLVRGGKELEVVQEDQHFSTDYQTIRVLKKMINILPSDVLITKCTYNT
EDRNKPTVGGFGIMEEMCVNYIHYYPRTQLELCKSHVDPGYLQKYFSFINRFHGNDQCVC
GDFGVTDQYDQLHWDDFAGEVLDSLYNTAPISMHCNQSTARLFPGEWEKQPLPEVISILP
KHRYPCEGGAESYS
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcttcagcaaagacgtccgccttcaggacatcaccatcatgtatttcactggc
ctggctgccctgatggtcatcctagtggcttcgtatcaggcgccctccaacgccatcgac
gtgtccagcctaaagccgagcccttccagttctctgccacctctccccatgcctttccat
atgcctttggacccacttggaaacctgcagctggcctggaacatcagctatgccacccag
gagatctacatacagctgagggttgcagagctcagacacggggtggtcctggggatgtcg
gaccgcggtgaactcaccaacgcagacctggtggtgctgtgggacaatggaacaaggagc
tactttggggacgcatggagtgacagcaaaggccatgtatcactggatagccatcaagac
tacgagctgattgaagctaaacagaaagctgatggattctacttgctcttcaaaagacca
tttagtacctgtgatcccagagattacgtcatagaggaaggaaccgtgcacatcatctat
ggcttgttggatcaaccacttgcctctcttggagatctgaacctgtccagaatccacatg
ggggtgcagagagtgttgatgcttcgccctgacatgctatcacccactctgcctccagat
gtgaagacgatggatgttcttgctccaaacgtcatcataccaaaccaagaaactacctac
tggtgcttcatccagaagttgtctgatgatatgcccaagaaccacattgtcatgtatgag
tctgtgataactccaggtaacgaagccatcgtgcatcatatcgaagtgtttgagtgtgca
ccagatctgcgagaggtaccacagtacagcggctcctgtgacgacaagatgaaacccaaa
aagctcaacttctgccgccatgtgctggctgcctgggcaatgggggctgaggctttttac
tatccccctgatgcaggcctggccataggtggacctggttcctcaaggtttctccgtttg
gaagtccattaccacaaccctctccttatatctggcaggcatgactcatctgggatacga
ctgcattacactcccaacctgaggcggtacgatgcagggatcatggagctgggcctcgtt
tacactcctgtcatggcgatccctccaaagcagcataccttctatctcactgggtattgc
acatcaaagtgcacccggactgctttgcctccaggaggcatctatgtatttgcctcacag
ttgcacacccacctggctggccgtggggtcagaacagttttggtgaggggagggaaagag
ctggaagtggtacaggaagaccaacacttcagtacagactaccagacaatccgagttctg
aagaaaatgatcaatattttaccaagcgacgtccttataacaaagtgcacgtacaacaca
gaggacaggaacaagcctacagtgggaggttttggcatcatggaggaaatgtgcgtcaat
tatattcattactaccctcggactcaactggagctctgcaagagccacgttgacccaggg
tacctgcagaaatattttagcttcattaacaggttccacggaaatgaccagtgtgtgtgt
ggcgattttggtgtgacagatcagtatgatcagctgcactgggatgattttgccggagaa
gtgctggactctctttataacacagctcccatctccatgcactgcaatcagtccactgca
cgcctctttcctggtgaatgggaaaaacagcccctaccagaagtgatctccatcctacca
aaacatcgctacccctgtgaaggaggtgcagagtcgtacagctga

DBGET integrated database retrieval system