KEGG   Xiphophorus maculatus (southern platyfish): 102218963Help
Entry
102218963         CDS       T02923                                 

Gene name
padi2
Definition
(RefSeq) peptidyl arginine deiminase, type II
  KO
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     102218963 (padi2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 699 aa AA seqDB search
MSQDISQTDSASNVPAFVLKRRGGAENHRTCRLDTDNPQGVLLVVGTSLKANLNRSAPPG
SNFFSVKCTPNVKFELRPPLGESSQQALIPLSGNSVILISMSKASQSEREDKLSVYYYGS
GSTSKVLGTAVLHLTAIEISLDVDADRDGIVEKNNPNKESWTWGPKGHGAILLVNCDSEN
IYNKSPDSEDPRKLKVADLKDMSLMVLRTRGPAELPEGYKLAMHISQGDAESVRVFRAAS
REVVKSSLHKIFSSFVKDYPLVLSSEVLSKKVPYLGGSAEMNFYVEGLRFPDKDFDGLIT
INLSLLQPVKAGIPETPIFTDKVVFRVSPWIMTPNTLQPVEVFVCSTSDNYQFLKGMKTL
VTRCGYKLKICHEYLNRGDRWMQDELEFGYIDSPHHSFPVVLDSPRDGKLDVFPYDELLG
PDFGYVTRVACRKDVSSLDSFGNLEVSPPVTVNGKKYPLGRILIGVAFPTATKGRNMTKV
VQDFLWAQKVQEPVALFSDWLCVGHIDEFMTFVPAPDRKGFRLLLASPDAGYKLFRGLSN
DGHGQAKMFDGVKKEVYVTVDDILRDENMRHENNYVQSCIDWNRDVLKRELGLDDDDIID
LPILFKLDDEDKSRAVAYYPDMVNMIVLGKNLGIPKPFGPKVNGRCALETEMCSLMEGLG
LNCVFIDDFASYHELMGEVHCGSNVRRKPFDFKWWNLEL
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagacatttcccaaactgattcagcgtccaatgttcctgcttttgtcctcaag
agaagagggggagcggaaaatcaccgaacatgccgcctggacacagacaatccacagggc
gtcctgcttgtcgttggcacatctttaaaggcgaatttgaacaggagcgcccctcctggc
tccaacttcttctcagtgaagtgcactcccaatgttaaattcgaactccgccctccactt
ggggagtcatcccaacaggccctgatacccctcagtggaaactcagtcatactcatcagc
atgagcaaggccagccaatctgaaagagaagataagctgtccgtctactattatggaagt
ggaagtaccagcaaggttttggggacagcagttctgcatcttactgccattgagatctct
cttgacgtggatgctgacagagatggtattgtggagaaaaacaacccgaataaggaatca
tggacatggggtcccaaagggcatggagctatccttctggtcaactgtgattcagaaaat
atatacaacaagtcaccagacagtgaggatccccgcaaactcaaagtggcagatcttaag
gacatgtcgctcatggtgctgcggaccagaggacctgcagaactcccagaaggctacaaa
ctcgccatgcacatctctcagggagacgcagagagtgttcgagtcttcagggctgcatcc
cgtgaagtggttaagagcagcctgcataaaatttttagttcctttgtaaaggactatcca
ttggtgctaagcagtgaggtgctgtctaagaaagtgccttaccttggaggctcagcagaa
atgaacttctatgtggagggtctgaggtttcctgacaaggactttgatgggctcatcacc
atcaaccttagcttactgcagccagtgaaggcgggcattcctgagacacccatttttaca
gacaaagtggtgttcagagtgtcaccatggatcatgacacccaacaccctccagcctgtg
gaggtgtttgtttgcagtacgtctgataactaccagttcctcaaaggaatgaagactctt
gttacacgttgtgggtacaaactgaagatctgccatgaatacctgaacagaggagatcgc
tggatgcaagatgaactggaatttggttacattgattcaccccatcactcatttcctgtg
gttttggattcccccagagatggaaaacttgatgtctttccttatgatgaactattgggc
cctgactttgggtatgtgaccagagtggcttgcagaaaagatgtgagcagcctggactcg
tttggtaatctggaggtcagtcctcccgtcacagtgaatggaaaaaaataccctctgggc
agaatcctcattggggttgccttcccaacggcaactaagggacgaaacatgaccaaagtg
gttcaagactttttgtgggctcagaaggttcaggagcctgttgccttgttttctgactgg
ctctgtgttggtcacatcgatgaattcatgacctttgttccggctcccgacagaaagggc
tttcgtctgctattggccagcccagacgcgggctacaaattattcagaggactgagtaat
gatgggcatggacaagccaagatgtttgatggtgtgaaaaaggaagtgtatgtgacagtg
gatgatatcctgagggatgaaaatatgcgacatgaaaataactacgtacagagctgcatt
gactggaacagggatgttctgaaaagagagctgggcctggatgatgacgacattattgac
ctcccaattctttttaagctggatgacgaggataaatccagagcagtggcttactaccct
gatatggtcaacatgattgttttggggaaaaaccttggcattccaaagccgtttggcccc
aaggtgaatggacgctgtgccctggagaccgagatgtgctccctgatggagggcctgggc
ctcaactgcgtcttcattgacgacttcgcctcctaccacgaactgatgggagaggtgcac
tgtggctccaacgtccgcagaaagccttttgacttcaaatggtggaaccttgagctgtga

DBGET integrated database retrieval system