KEGG   Xiphophorus maculatus (southern platyfish): 102218963Help
Entry
102218963         CDS       T02923                                 

Definition
protein-arginine deiminase type-2-like
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 675 aa AA seqDB search
MAHRRTLRVNYNKATNVVCVVGSELSVNLDRSAPPGSNFFSVKCTPNVKFELRPPLGESS
QQALIPLSGNSVILISMSKASQSEREDKLSVYYYGSGSTSKVLGTAVLHLTAIEISLDVD
ADRDGIVEKNNPNKESWTWGPKGHGAILLVNCDSENIYNKSPDSEDPRKLKVADLKDMSL
MVLRTRGPAELPEGYKLAMHISQGDAESVRVFRAASREVVKSSLHKIFSSFVKDYPLVLS
SEVLSKKVPYLGGSAEMNFYVEGLRFPDKDFDGLITINLSLLQPVKAGIPETPIFTDKVV
FRVSPWIMTPNTLQPVEVFVCSTSDNYQFLKGMKTLVTRCGYKLKICHEYLNRGDRWMQD
ELEFGYIDSPHHSFPVVLDSPRDGKLDVFPYDELLGPDFGYVTRVACRKDVSSLDSFGNL
EVSPPVTVNGKKYPLGRILIGVAFPTATKGRNMTKVVQDFLWAQKVQEPVALFSDWLCVG
HIDEFMTFVPAPDRKGFRLLLASPDAGYKLFRGLSNDGHGQAKMFDGVKKEVYVTVDDIL
RDENMRHENNYVQSCIDWNRDVLKRELGLDDDDIIDLPILFKLDDEDKSRAVAYYPDMVN
MIVLGKNLGIPKPFGPKVNGRCALETEMCSLMEGLGLNCVFIDDFASYHELMGEVHCGSN
VRRKPFDFKWWNLEL
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggctcatcggcggactctccgagtaaattataataaagcgaccaacgtagtgtgcgtg
gtcggctcggaactcagcgtaaacttagacaggagcgcccctcctggctccaacttcttc
tcagtgaagtgcactcccaatgttaaattcgaactccgccctccacttggggagtcatcc
caacaggccctgatacccctcagtggaaactcagtcatactcatcagcatgagcaaggcc
agccaatctgaaagagaagataagctgtccgtctactattatggaagtggaagtaccagc
aaggttttggggacagcagttctgcatcttactgccattgagatctctcttgacgtggat
gctgacagagatggtattgtggagaaaaacaacccgaataaggaatcatggacatggggt
cccaaagggcatggagctatccttctggtcaactgtgattcagaaaatatatacaacaag
tcaccagacagtgaggatccccgcaaactcaaagtggcagatcttaaggacatgtcgctc
atggtgctgcggaccagaggacctgcagaactcccagaaggctacaaactcgccatgcac
atctctcagggagacgcagagagtgttcgagtcttcagggctgcatcccgtgaagtggtt
aagagcagcctgcataaaatttttagttcctttgtaaaggactatccattggtgctaagc
agtgaggtgctgtctaagaaagtgccttaccttggaggctcagcagaaatgaacttctat
gtggagggtctgaggtttcctgacaaggactttgatgggctcatcaccatcaaccttagc
ttactgcagccagtgaaggcgggcattcctgagacacccatttttacagacaaagtggtg
ttcagagtgtcaccatggatcatgacacccaacaccctccagcctgtggaggtgtttgtt
tgcagtacgtctgataactaccagttcctcaaaggaatgaagactcttgttacacgttgt
gggtacaaactgaagatctgccatgaatacctgaacagaggagatcgctggatgcaagat
gaactggaatttggttacattgattcaccccatcactcatttcctgtggttttggattcc
cccagagatggaaaacttgatgtctttccttatgatgaactattgggccctgactttggg
tatgtgaccagagtggcttgcagaaaagatgtgagcagcctggactcgtttggtaatctg
gaggtcagtcctcccgtcacagtgaatggaaaaaaataccctctgggcagaatcctcatt
ggggttgccttcccaacggcaactaagggacgaaacatgaccaaagtggttcaagacttt
ttgtgggctcagaaggttcaggagcctgttgccttgttttctgactggctctgtgttggt
cacatcgatgaattcatgacctttgttccggctcccgacagaaagggctttcgtctgcta
ttggccagcccagacgcgggctacaaattattcagaggactgagtaatgatgggcatgga
caagccaagatgtttgatggtgtgaaaaaggaagtgtatgtgacagtggatgatatcctg
agggatgaaaatatgcgacatgaaaataactacgtacagagctgcattgactggaacagg
gatgttctgaaaagagagctgggcctggatgatgacgacattattgacctcccaattctt
tttaagctggatgacgaggataaatccagagcagtggcttactaccctgatatggtcaac
atgattgttttggggaaaaaccttggcattccaaagccgtttggccccaaggtgaatgga
cgctgtgccctggagaccgagatgtgctccctgatggagggcctgggcctcaactgcgtc
ttcattgacgacttcgcctcctaccacgaactgatgggagaggtgcactgtggctccaac
gtccgcagaaagccttttgacttcaaatggtggaaccttgagctgtga

DBGET integrated database retrieval system