KEGG   Xiphophorus maculatus (southern platyfish): 102220266Help
Entry
102220266         CDS       T02923                                 

Definition
NADPH--cytochrome P450 reductase-like
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     102220266
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 673 aa AA seqDB search
MADMDPETTTNTAGEEEPLFSNLDLFLFSLIVGLVIYWFMSRKQPEPIPEFKKLDTPTPT
TRETSFVEKMKKTGKNIIVFYGSQTGTAEEFANRLAKDSQRYGMKGMAADPEEYSMGELA
RLAEIENSLAIFCMATYGEGDPTDNAQDFYDWLQENDDEDLSGLNYTVFSLGNKTYEHYN
AMGKYVDKRLEELGAKRIFDLGLGDDDGNLEEDFVSWREQFWPAVCEHFGVEASGDESSI
RQYELKVHTDVNMNKVYTGEIGRLKSFEVQKPPFDSKNPFLAPVTVNRKLNKAGDRHLMH
LELDITGSKIRYESGDHVAVFPTNDSELVNKLGEILGVDLDVVISLNNLDEESNKKHPFP
CPTTYRTALTHYLDITNPPRTNVLYELAQYASDPKDQENMRKMASSSPEGKALYQNWVLD
SCRNILAVLEDMPSLKPPIDHLCELLPRLQARYYSIASSSKVHPNSIHICAVVVEYKTKT
GRFNKGVATNWLKNKLVNGHKSTVPMYIRKSQFRLPFKASNPVIMIGPGTGIAPFMGFIQ
ERGWLKQQGKEVGETVMYFGCRHKNEDYIYQEELEEAEKNNFLTQLNVAFSRDQDHKIYV
QHHLKKNKEHLWKLINTDNAHIYVCGDARNMAKDVQTAFYEIAEEYGSMTRTQATDYVKK
LMTKGRYSQDVWS
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggccgacatggaccccgagaccaccaccaacaccgcaggcgaagaggagcctctcttc
agcaacctggacctcttcctcttctctttgattgtgggccttgtcatttattggttcatg
tcccgcaagcagcctgagcccatccccgagtttaagaagcttgataccccaacacccacc
acccgagagacgagttttgtcgagaaaatgaagaaaactggaaagaacatcatagttttc
tacggctctcagacggggacagctgaggagtttgccaacaggctcgccaaagattctcag
cgctacggcatgaaaggaatggctgccgatccggaggaatacagcatgggggaactggcc
cgtctggctgagattgagaactctctcgctatattctgcatggccacatacggagaagga
gatcccactgataacgcccaggacttttatgactggctgcaggagaatgatgatgaagac
ctctctggcctgaactacactgtgttttctttgggcaataagacctacgaacactacaac
gctatgggaaaatatgtagacaaaaggctggaagaactgggagccaagcgcatctttgat
cttggtctgggtgatgatgatggcaaccttgaggaggatttcgtctcttggagagaacag
ttctggccggcagtctgtgagcactttggtgtggaggcgtcaggagatgagtcaagcatt
cggcagtacgagctgaaggtgcacactgacgtcaacatgaacaaagtttacacaggagag
attggtcgtctgaagagttttgaagtccaaaagcctccctttgattccaagaacccattc
ctggctccagtcactgtcaaccgtaaactcaacaaagctggcgacagacaccttatgcac
ctagagctggacatcacaggctccaagatcagatacgagtcaggagaccacgtcgctgtt
ttccccacaaatgactcagagctggtgaacaagctgggagagatccttggcgtggacctt
gatgtggttatctctctcaataaccttgatgaggagtccaacaagaagcatccgttcccc
tgtcccaccacctaccgcaccgccctcactcactacctggacatcacaaaccctccccgc
accaacgtcctgtacgagctggcgcagtacgcctccgaccccaaagaccaggagaacatg
cgaaagatggcttcctcatctcccgagggcaaggctctctaccagaactgggtgttggac
tcctgcagaaacatcctggctgttctggaggatatgccttctttaaagcctcctattgac
cacctgtgtgagctgctgcctcgtctccaggctcgctactactccatcgcctcttcgtct
aaagttcaccccaacagcatccacatctgtgccgtggtggtggagtacaagaccaagaca
gggcgcttcaacaagggagtcgcaaccaactggctgaaaaacaaactcgtcaacggccac
aagtccaccgtgcccatgtacatccgcaagtcccagttccgcctgccattcaaggcctcc
aacccagtgatcatgatcggcccgggcactgggattgctcctttcatgggcttcatccag
gagagaggctggctcaaacagcaagggaaggaagtaggagagacggtgatgtatttcggc
tgcagacacaaaaacgaggattatatttaccaggaggagctggaggaggcagagaagaac
aacttcttaacgcagcttaatgttgctttctccagagaccaggaccataagatttatgtg
caacatcatctgaagaagaacaaggaacacctctggaagctaatcaacacagataatgct
catatctatgtttgcggtgacgcgaggaacatggcaaaagacgtgcagactgctttctac
gagatcgcagaggaatacggcagtatgactcgcacccaggccacagattacgtcaagaaa
ctgatgaccaagggacgctactcgcaggacgtgtggagctaa

DBGET integrated database retrieval system