KEGG   Xiphophorus maculatus (southern platyfish): 102220383Help
Entry
102220383         CDS       T02923                                 

Definition
ectonucleoside triphosphate diphosphohydrolase 2-like
Orthology
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    102220383
Enzymes [BR:xma01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     102220383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 504 aa AA seqDB search
MAQFSSLPIAPIALLLFGLVGILLLTIPSQDVQDAPGFLYGIVLDAGSSHTSLYIYKWPA
DKQNGTGVVTQHSECSVDGGGISSYAGQVGAAGRSLRACLNRAVEEIPKEKHPNTPVYLG
ATAGMRLLNKSSPQQSDQVLAEVGSEIQSFPFSYRGAVILSGREEGAYGWVTVNYLQGNF
IKFGFVGRWFSSGRATVGALDFGGASTQITFVTQQKVEDEANRKELRLYGHVYSLYTHSF
LCYGQDQLLKKLLAQIVKSQGYAPEVNHPCYPANFTRTLKMENIFDSPCTVQYKPDTYNP
QRSLTLRGSGHYQNCFHNVSELFRYDGCPFSRCSFDKVFQPKVTGNFMAFSAFYFIHSSL
QKVTGVKVSTPLQLENATKTVCSMNYSQLQMMSEAENPDRLKDFCASSVFIKALLLRGYG
FDDASFPGISFQNTAGDASVGWAMGYMLVLSNLLPAESAGVRKSLTVGAWGMLLFLFIVL
LIICVCLLFRARSKRKKGGDESTI
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggctcagttttcctcccttcccatcgctcccatcgcgctgctgctgttcggactggtc
ggcatcctgctgctcaccattccctcccaggacgtccaggacgcgccggggttcttgtat
gggattgtcctggatgccggttcttcccacacgtctttgtatatctataagtggcctgca
gataaacaaaatggcaccggcgtggtcacccagcacagcgaatgctctgtggacggtggg
gggatttctagctacgctggccaagtcggagcggcgggccgaagcttacgggcgtgtctg
aaccgggccgttgaagagattcccaaagagaaacacccgaacacacctgtgtacctggga
gccacggccggcatgaggctgttgaataagtccagtccacagcagtcggatcaggttctg
gccgaagtgggcagcgagatccagtcgtttcctttcagctacagaggagcggtgatcctg
agcggacgggaggagggcgcctacggctgggtcaccgtcaactacctgcagggaaacttc
atcaagttcgggtttgtgggacgttggttcagctccggcagagcgacggtgggagcgctg
gacttcggcggcgcgtcgacgcagatcacgtttgttactcagcagaaggtggaggacgaa
gcaaacaggaaggagctgcgtctctacggccatgtttactcgctgtacactcacagcttc
ctgtgctacggccaggaccagcttttaaagaaactgctggcccaaatcgtgaagtctcag
ggttatgctccggaggtcaatcatccctgctatcctgcaaacttcaccaggacactgaaa
atggagaatatcttcgactcgccatgcaccgtgcagtacaaacccgacacctacaaccct
cagaggagcttgacgctacgtggcagcggacattaccagaactgctttcacaacgtgtcc
gaactcttccgctacgacggctgccccttctcgcggtgttcgtttgataaagtcttccag
ccgaaagtcaccggcaacttcatggcgttttctgctttttacttcattcactcgtccctg
cagaaggtcacaggggtcaaggtcagtacgcccctgcagctggagaacgccaccaagacg
gtgtgcagcatgaactacagccagctgcagatgatgtcggaggcagaaaatcccgatcgt
ctgaaggatttctgcgcttcctctgtgttcatcaaagctctgctgctgagaggatacggc
tttgacgacgcgtcgttccctggcatttcctttcagaacacggcaggcgacgcgtcggtg
ggctgggctatgggctacatgctggtgctgagcaatttgctgcctgcggaaagcgccggg
gtgaggaaatctctcaccgtcggagcgtggggaatgctcctcttcctcttcatcgtcctc
ctcatcatctgcgtctgtctgctgtttcgagcgcgaagcaagaggaagaaaggaggcgat
gaaagcaccatctag

DBGET integrated database retrieval system