KEGG   Xiphophorus maculatus (southern platyfish): 102220855Help
Entry
102220855         CDS       T02923                                 

Definition
(RefSeq) alanine aminotransferase 2-like isoform X1
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00220  Arginine biosynthesis
xma00250  Alanine, aspartate and glutamate metabolism
xma01100  Metabolic pathways
xma01200  Carbon metabolism
xma01210  2-Oxocarboxylic acid metabolism
xma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102220855
   00220 Arginine biosynthesis
    102220855
Enzymes [BR:xma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     102220855
Amino acid related enzymes [BR:xma01007]
 Aminotransferase (transaminase)
  Class I
   102220855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 102220855
NCBI-ProteinID: XP_005800010
Ensembl: ENSXMAG00000017178
Position
6
AA seq 562 aa AA seqDB search
MSATRVQLISPRTLRLLSPGRSALFLPGGGGPHRGGGVPGFRSLIFPSLSSSFSSPGRAL
SSLSTTRRGLPKTKMSDNGTMTRGKVLTIDNMNPTVKKVEYAVRGPIVQRAVELEKELSE
GRKKPFAEVIKANIGDAQAMGQQPITFFRQVLALCSYPELLSDSTFPEDAKSRACRILNS
CGGNSMGAYSASQGIGSVRQDVARYIERRDGGVPCEPDNIYLTTGASDGIVTMLKLLVCG
EGATRTGVMISIPQYPLYSAALAELSAVQINYYLNEEKCWSLDIGELQRALDEARLHCNP
RALCIINPGNPTGQVQSRECIEDVIRFAAKERLFLMADEVYQDNVYAEGCQFHSFKKVLF
EMGPEYSETVELASFHSTSKCYMGECGFRGGYMEIINMDDDVKDQLTKLLSVRLCSPVPG
QALMDLVVNPPQPGEPSYERFIKERTATLSALAEKARLTEQVLNTVEGIRCNPVQGAMYS
FPRITIPEKAIQEAKKLGQQPDMFYCMKMLEETGICLVPGSGFGQREGTYHFRMTILPPT
DKLKILLNNVKEFHQRFTQQYS
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccacgcgtgtgcagcttatttcacccagaaccctacggcttctaagcccgggg
cgaagcgcgctgttcttacccggcggcggtggaccgcatcggggtggcggtgttcccggg
ttccgctcactcatctttccttctctgtcctcctccttttcttctcccggcagagcctta
tccagtttgagcactacgcggcgtggacttcccaaaacaaaaatgtccgataacgggacg
atgactcggggcaaggtgctgaccatcgacaacatgaaccccacagtgaagaaggtggag
tacgccgtgcgggggcccatcgtgcagcgagccgtggagctggagaaggagctcagtgag
ggaaggaagaagcccttcgcagaggtcatcaaggccaacattggtgatgcgcaggccatg
ggccagcagccaatcacttttttccgacaggtgctggcgctgtgttcctatcctgagctg
ctgagtgacagcacattcccagaggatgcgaaaagtagagcatgtcgcattctgaactcc
tgtggagggaacagtatgggtgcctacagtgcaagtcagggcataggctctgtacgtcag
gatgtggctcgttacatcgaaaggcgtgacggcggcgtgccctgcgagccagacaacatt
tacctcaccacgggggccagcgacggcattgtgaccatgctgaagcttctggtgtgtggc
gaaggtgcaacgcgcacaggtgtcatgatctccatacctcagtaccccctgtattcagcc
gcacttgctgagctcagcgctgtgcagatcaattattaccttaatgaagaaaagtgctgg
agtctggacatcggtgagcttcagcgagctttggatgaggccagactccactgcaacccc
cgcgccctgtgcatcatcaaccctggaaatcccacaggtcaggtgcagagcagagagtgc
attgaggatgtaatccgatttgctgcaaaagagcgtctcttcctcatggccgatgaggtg
taccaggataatgtgtacgctgaaggttgccagttccactcctttaagaaggttctgttt
gagatggggccggagtactctgaaacagttgaactggcatcgttccactccacctccaag
tgttacatgggagagtgtggcttccgcggcggctacatggagatcatcaacatggacgat
gatgtaaaggaccagttgaccaagctgctttcggtccgtctctgttctcctgttcctggc
caagctctaatggacctggtggtaaacccccctcagcctggggaaccttcatatgagcgc
ttcatcaaggaacgcacggctaccttaagtgccttagcagagaaggccagacttactgag
caggtactcaatactgtggagggcatccgctgcaatcctgtgcagggtgcgatgtactcc
tttcctcgcattaccatacctgaaaaggccatccaagaggccaagaaacttggtcagcag
ccggatatgttttactgcatgaagatgctggaagagacgggaatttgcctcgtccctgga
agtggttttggccaaagagaaggaacgtaccacttcagaatgaccatcttgccaccaaca
gataagctgaagatcctgctgaacaacgttaaggagttccaccagaggttcacccagcag
tattcctaa

DBGET integrated database retrieval system