KEGG   Xiphophorus maculatus (southern platyfish): 102220981Help
Entry
102220981         CDS       T02923                                 

Definition
7-dehydrocholesterol reductase-like
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Steroid biosynthesis
Metabolic pathways
Module
Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    102220981
Enzymes [BR:xma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     102220981
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 472 aa AA seqDB search
MESTRRRPQHHANGKGSEAVEKSAQWGRAWEVDWFSLISVVGLLCFAPFIVFYFVMACDQ
YECSISQPLLELCQGKATLLSIWARAPSFTWTAAKIYAIWVSFQVFLYMCIPDVTHKFIP
GYVGGVQDGARTPAGFINKYEINGLQCWIITHALWFANSNYFHWFSPTIIFDNWIPLLWC
TNILGYSVSTFAFVKAYLFPTNAEDCKFTGNIFYNYMMGIEFNPRIGKWFDFKLFFNGRP
GIVAWTLINLSYMAKQQELYGHITNSMMLVNVLQGIYVLDFFWNEAWYLKTIDICHDHFG
WYLGWGDCVWLPYLYTLQGLYLVYHPVQLSDTHAVAVLLLGLVGYYIFRSTNHQKDLFRR
TEGACSIWGRKPTYIECSYLSADGRSHRSKLLTSGFWGVARHFNYTGDLMGSLAYCAACG
FGHILPYFYIVYMTILLVHRCVRDEHRCSSKYGKDWRRYTDTVPHRLIPGLF
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggagtccacaaggaggcgccctcagcaccatgccaatgggaaagggtctgaagctgtg
gagaagtcagcacagtggggaagagcatgggaggtggactggttttccctgatcagtgtc
gtcggcctcctttgcttcgctcccttcatcgtcttttactttgtgatggcctgcgatcag
tacgagtgctccatcagccagcctctgttagagctgtgccagggaaaggcaaccttgctg
tccatctgggcccgggccccctccttcacatggactgctgctaagatatatgccatctgg
gtgagctttcaggtgttcctctacatgtgtattcctgacgtcacccataagtttattccg
ggctacgtgggtggagtgcaggatggagctcgtacccctgctggttttattaacaagtat
gagatcaacggcctgcagtgttggatcatcacccatgctctgtggtttgcaaactccaat
tatttccactggttttctcctaccattatatttgacaactggatccccctgttatggtgt
accaatatactgggctattctgtgtctacctttgcctttgtaaaggcctacctgttcccc
accaatgctgaggactgcaagtttacagggaacatattttataactacatgatggggata
gagttcaaccctcgcatcggcaagtggttcgacttcaagctgttcttcaatggcaggcct
ggcatcgtcgcctggaccctgattaatctgtcttacatggccaagcagcaggagctgtac
ggtcacatcaccaactccatgatgctggtcaacgtgctgcaggggatttatgtgctggat
ttcttctggaatgaggcgtggtacctgaagaccattgatatctgccatgaccactttggg
tggtatctaggctggggggactgtgtgtggctgccgtacctctacaccctgcagggcctg
tacctggtgtaccatccggtccagctatcagacactcacgccgtcgccgtactgttgctc
ggtctcgttgggtattacattttccgctccaccaaccatcagaaagatctgttccgccgc
acagagggcgcctgctccatctgggggcgtaagcccacctacatcgagtgttcgtacctg
tccgccgacggccgcagccaccgcagcaagcttctgacctcagggttctggggagtggcg
cgtcacttcaactacactggcgacctgatgggttccttggcttactgtgccgcctgtggc
tttggccacattcttccatacttctacattgtttacatgaccatcctgctggtccaccgc
tgtgtgcgagacgaacaccgctgcagcagcaagtacgggaaagactggagacgttacacc
gacacagtgcctcacaggctgattcctggactgttttaa

DBGET integrated database retrieval system