KEGG   Xiphophorus maculatus (southern platyfish): 102221588Help
Entry
102221588         CDS       T02923                                 

Gene name
kat6a
Definition
(RefSeq) histone acetyltransferase KAT6A
  KO
K11305  histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102221588 (kat6a)
Chromosome and associated proteins [BR:xma03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102221588 (kat6a)
   HAT complexes
    MOZ/MORF complex
     102221588 (kat6a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MOZ_SAS PHD Linker_histone Acetyltransf_7 PHD_2 CotH Acetyltransf_1
Motif
Other DBs
NCBI-GeneID: 102221588
NCBI-ProteinID: XP_023198938
Ensembl: ENSXMAG00000010515
Position
12
AA seq 2226 aa AA seqDB search
MVKLANPVYTQWILEAIKKVKKQKQRPSEERICNAVSMSHSLDRKTVLEQLELSVKDGTI
LKVTNKGLNSYKDPDNPGRLSLPKPKGSGGAGGGVAASAGGGSNNGACGTSHSHSGKKPG
LDWNKLIKRALEGLHEPGGSSLKNVERFLKCQADVAAYLSSSGSIGAGLFHQQLRVALKR
AVAHGRVVKQGQTFQLVSRGGCQNDGTGTVSLETLPPVRLLPHEKDKPVAEPIPICSFCL
GTKEQNRDKKPEELISCADCGNSGHPSCLKFSPELTARVKALWWQCIECKTCSSCQDQGK
NADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICQPRNKGKTLLHEKAAQIKRRYNA
PLGRPKNRPGRPFKKLGGRGRRKRSTSANSSSSSSCEGYPGDDRLLFSMRGDDEQSNSSL
HFNSKTKGLIDALTKFFTPSPAGRKARQEVVDYSQQCRIRKKAGRKGEGDDGGDNQDGSD
WREDEDKLPGHENLTEKDIELFKHIQELALQKVGVTGPPDPQMRCPSVIEFGKFEIQTWY
SSPYPQEYSRLPKLYLCEFCLRYMKSRSILYQHMKKCSWFHPPANEIYRKDKVSVFEVDG
NVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDNKGCHLVGYFSKEKHCQQKYN
VSCIMILPQYQRKGYGRFLIDFSYLLSKREGQPGSPEKPLSDLGRLSYMAYWRSVVLECL
HEVRDRQLTIRQLSKKTGICPQDITTTLHSLNMLEQRGDRLVLVRREKVVANHMARLKAR
PRQLEVDPECLRWTPVIVTNTVVSETDGEEEEEDDEGPDDGIHKGMKLSHKVPTTPWQMQ
QRVEDEETKGFLGFPINQSTPASPSVHGPPSVPDPAHPPLPTNGERRPRGRPPKNCPWGK
IKNSTRVGRPPKIRPMEDEDDEDDEILEEGRTAGSSSSPPSLFSMDRQGDSSAFHSLDLA
RHPSITPTTRRGRPPRKKRGPKPRLPDGTGEGLTQSVLFRLNEAASVSKSCFSESSDDEE
EDDDEDDEEERGCSPPILTKPAIGLKCKKPLKRPRFRRSSHPQSSVVTETISETTEVLDE
PFVDSDSERPMPRLVEETSLGHPLRRYPPARSALRLSEPTPKRARHSNLSDSEEDDLTPV
LSVSALAARPSELPMVNPEVPVKKKKGWPKGKSRKPQWAKCDPGKPPGGGPNQEGGQIQS
RDLHTPKIKMKPGRKPRGWYLQREEAEKQEKERQRLDKDSQLLQGEDHTTASLRLGETDK
QKDSDDDDYFPKPTEQKVPKRRGRPPKNRSIHLPPQPAPKPPPTSEPDEEDEEDDDEDTE
TAWVDDKPSRPPSRPLLSPSSSSSASGPRAQHSQPHDAEVADGQDDDDNEDREEEESGSM
GSGGSSVTRRMAVTPGSGSRRSEEHDADDEGDGHLEDKSNSCKSRKRQDSDDEEDEEDEE
DEDEPTSRPNSPPVKEEPQGGEAFLDMDNSVVPSYVSKQEEDEEEEEAEKEVQEAKSPPP
SADPVQEERRRREQEESAAAAAAVETVTAMAVPSENMQLESLHPDDKDVTLLMEPQHAHS
HPHQHAEYKEELGQHHPHHQHQHSNELDLETMQAVQSLTQGEVQEEEAEPQPHHGAYQDC
EETLAACRTLQSYSHTGENEEEGLPLVEECGASQHSSPLPNPPVPPLPNQSVRSVNSPGM
SSGVVESTPAGQRGGTPGPAGSTGSSTGSGYTQITPEHPSSLSAPSQQNMETSPMMDVPS
VSDHSQQVVDSGFSDLGSIESTTENYDNPSSYDSTMGGGGGNGTGNGGNGGAMSGAVVAG
PSATTSSSSSSTSATPSSSSTQSNSCSFVQTPSLTPSTANGGSQLGMGSCSLIQQTGPGA
SNTVPQPPPPPPPSNTPSCGIKSPQSCGVIERPPSTNQQQQQPQSQKKVPQQPPQQTPNP
QSQPSAPPPPQQQALSQCSMGNGFASTPMIMEIPESGGGGGGGRAIYERMSQDFGTGSYP
QSTATFSLAKLQQLTNTIMDPHAMPYSHSASVTSYATSVSLSNPGLAPSPHALPQGQPTM
TSPANLSSGSMNLGSLQLQCNMPATNISLGPPQSHRLQGQMATVKGHISIRSKATQQLAP
ASHQQQLYGRSSAMQGTTRTLTVQRGMMPNLMPTPAPYNSMNMTPLNAMSAGYRMPQSMM
NSGYHSNPPYMNQPAQYPMQMQMGMMGGQGYPQQPMQPNHHSNMMYTGPSHHSYAGVPKQ
SPYMSR
NT seq 6681 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagctggccaacccggtttacacccaatggatcctagaggccattaagaaggtc
aagaagcagaagcagcgaccgtcggaggagcgcatttgcaatgcggtgtcgatgtcccac
agtttggaccgcaagacagttctggagcagctggagctcagcgtcaaggacggcaccatc
cttaaggtcaccaacaagggcctcaactcctacaaagacccagacaaccctgggcgcttg
tctctgccgaagccaaaaggcagcggcggcgcaggaggtggtgtagctgcatcagcggga
ggcggcagcaataatggcgcctgcggcacgtctcattcgcactccggcaagaaacccgga
ctcgactggaacaagctgatcaagcgggcactggagggcctccacgaacccggcggctcc
agcttgaaaaacgtggagcgcttcctgaagtgccaggcggacgtggcggcctacctgtcg
agcagcggctccataggagccggcctcttccaccagcagctgagggtggctctgaagaga
gcggtggcgcacggccgcgtggtcaagcaggggcagaccttccagctggtgagccgcggc
ggctgccagaacgacgggactgggacggtgtctctggaaacgctgccgcccgttcgactg
cttcctcatgagaaggacaagcccgtggcggagcccatccccatctgcagcttctgtctg
gggaccaaggagcagaaccgcgacaagaagccggaggagctcatctcctgcgccgactgc
ggcaacagcggccacccgtcctgcctcaagttttccccagagctcacggcacgagtcaaa
gctctgtggtggcagtgcatcgaatgcaagacctgcagcagctgtcaggatcaggggaag
aatgcggataacatgttgttctgtgattcttgtgaccggggcttccacatggagtgctgc
gatccgcctctcacacggatgcccaaaggcatgtggatttgtcaaatctgccaacccagg
aataagggaaagacgcttctgcacgaaaaggcggcgcagatcaaacggcgatacaacgcg
ccgctggggcggcccaagaacagaccagggcgacccttcaagaagctgggaggccgaggt
cggaggaagcgctccacctcggccaactcttcctccagctcctcttgcgaaggttacccc
ggcgatgaccggctacttttttcgatgcgcggggacgacgagcagtccaacagcagcctg
cacttcaacagcaagaccaagggcctcatcgacgccctcaccaagttcttcacgccgtcg
ccggcgggccgcaaggcgcggcaggaggtggtggactactcgcagcagtgccgcattcgg
aagaaggcggggcggaaaggagaaggagatgacgggggtgacaatcaggacggcagcgac
tggcgggaggacgaagacaaactgcccggacacgagaacctgacagaaaaagacattgaa
ctgttcaaacatatccaggagctggcgcttcagaaagttggcgtgactggtccaccagac
ccacagatgcgctgtccgtcagtcattgaatttggcaagtttgaaatccagacctggtac
tcgtctccgtacccgcaggagtacagcaggctccccaaactatacctgtgtgagttctgc
ctgcgctacatgaagagccgcagcatcctctaccagcacatgaagaagtgcagctggttc
caccctccggccaacgagatctacaggaaggacaaggtttctgtttttgaggtcgatgga
aatgttagcacaatctactgtcagaacctgtgtctgctggccaagctgttcctggaccac
aagaccctttactatgacgtcgagcccttccttttctacgtcctcacgcagaacgacaac
aaaggttgccatctggtcggctacttctccaaggagaagcactgtcaacagaaatacaat
gtatcatgcatcatgattcttccacaataccagcgcaagggctacggacgctttctcatc
gactttagctacctgctgtcaaaacgggaagggcaacccggctccccggaaaagcctctg
tcggacctgggccggctgtcctacatggcgtactggcgcagcgtggtgctggagtgtctc
cacgaggtccgcgaccggcagctcaccatacggcagctcagcaagaagacgggcatctgc
ccgcaggacatcaccaccaccctgcacagcctcaacatgctggagcagcgaggagacagg
cttgtgttggtgcgaagggaaaaagtggtggccaaccacatggctcgcctcaaggctcgg
ccgcggcagctggaagttgaccccgagtgtctccgctggacaccggtcattgtcacaaac
acagtcgtctcagaaacggatggagaggaggaagaggaggacgacgaaggaccagacgat
ggcattcataaggggatgaaactaagccacaaggttccaacaacaccctggcagatgcag
cagagagtggaggatgaagaaacgaagggcttcctggggtttcccatcaaccaaagcacc
ccagcttccccgtccgtccatggcccgccgtctgtcccagacccggcgcaccctcctctg
ccgacgaacggcgagcgtcggccgcggggtcgtccacccaaaaactgcccctggggcaag
ataaagaatagcacgcgcgtcggacggccacccaagatccgccccatggaagacgaggac
gatgaagacgatgagattctggaggagggccggacggctggctcttcgagcagcccaccg
tcccttttctccatggatagacaaggagactcctcagcttttcactctctggacttggcg
aggcacccttccataacccctacgacgcgaagagggcgaccgccgagaaagaagaggggc
ccgaagcctaggcttccagacgggaccggggaggggctgacacagtcggtcctgttcagg
ttaaacgaagcggcgtccgtcagcaagagctgcttcagcgagagcagcgatgacgaggag
gaggatgacgacgaagatgacgaggaggagaggggatgctccccgcccatcctcaccaag
ccagcaatagggctcaaatgcaagaagcccctaaagaggcctcgttttcgtcggagcagt
cacccacagagcagcgtggtgacagagaccatttccgagacgacggaggtgttggatgag
ccctttgtagactcagactccgagaggcctatgcccagacttgtagaggaaacgtccctg
ggccacccactgcgtcgctaccccccagcgagatctgctctgagattgtctgagccaaca
cccaagagagctcgccactccaacctctctgattcagaggaagatgatctaacacctgtg
ctgagtgtatccgctctggcagcgaggccatcagagttacctatggtcaaccccgaggtc
cctgtcaagaagaagaagggttggccaaaaggaaagagccgcaaaccgcagtgggcgaaa
tgcgatcccgggaaaccccccggtggtgggcctaaccaagaaggcggccagatccaaagc
agagatttgcacacccctaaaatcaaaatgaagcctggccgcaagccgcggggctggtac
cttcaacgggaggaggctgagaagcaggagaaggaaagacagcggctggacaaagactcc
cagctgctccagggagaggatcacactaccgcaagtctgcgactcggcgaaactgacaaa
caaaaagactcggacgatgacgactacttccctaagcctaccgaacaaaaagtgcccaaa
aggcgagggaggccgccaaagaaccgttccattcacctgccaccgcagcctgcccccaag
cctccacccacctccgagccggacgaagaggatgaagaagacgacgatgaggacactgaa
accgcatgggtggacgacaagcccagccgtccaccatcccgtcccttactgtccccctcg
tcttcctcgtctgcgtcagggccacgggcccaacattcccaaccccacgacgcagaggta
gctgacgggcaggacgatgacgacaacgaagacagggaagaagaggaaagtggcagcatg
ggcagcggaggcagcagcgtcaccaggcgaatggccgtcacaccgggttccggcagcagg
cggagcgaagagcacgacgcggatgacgaaggtgacgggcatttagaagacaagagcaac
agctgcaagtcgagaaaaagacaagattcggatgacgaagaagacgaagaggatgaggag
gacgaggacgagcccacctctcggccaaactctcctccggtcaaagaagaaccccaaggt
ggcgaggcttttttagacatggacaacagcgtggtgccaagctatgtcagcaagcaggag
gaagacgaggaggaggaggaggctgagaaggaggtgcaggaagccaagtctccgcctcct
tccgccgaccccgtgcaggaggagaggcggcgcagggagcaagaggagtcggccgcagcg
gctgcagccgtggaaacagtcaccgctatggccgtcccttctgagaacatgcagctggag
tcgctacacccggacgacaaagacgtcacgctgttgatggaaccccaacacgcacactcc
cacccacaccagcacgccgagtataaggaggagttgggccaacaccatccgcaccaccag
catcagcattccaacgagctggacctggagacgatgcaggccgtgcagtcgctgacgcaa
ggagaggtccaggaggaagaggcagagccgcagccccaccatggcgcttaccaagactgc
gaggagacactagctgcctgccggactctgcagagttatagccacacgggggagaacgaa
gaggagggtctgcctttagtggaggagtgtggagcttcacaacatagcagcccactccca
aaccctccagtgcctcctttgcccaaccagtctgttcgctcggtcaacagcccagggatg
tcttcaggtgtcgtggagagcacacctgccggacagaggggcggtacgccgggccccgcc
ggatccacaggcagcagcaccggcagcggctacacccaaatcactccagaacacccgagc
tcactgtctgccccatcccagcagaacatggagacttctccgatgatggacgtgccgtcg
gtgtcggaccactcgcagcaggttgtggacagtggcttcagcgacctgggcagcatcgag
agcacgacagagaattacgacaaccccagcagctacgactccactatgggcggcggaggg
ggcaacggaacaggaaatgggggtaatggaggggcgatgtcgggcgccgttgtggcagga
ccctccgccacaacgtcatcttcctcctcctccacctctgccactccatcgtcctcgtct
acgcaatccaacagttgctcctttgtgcagactcccagcctcacaccctccacagccaat
ggggggtcccagttgggaatgggcagctgtagcctcatccagcaaactggaccaggagct
agtaacaccgtgccgcagcctccgccacccccacctccttccaacacccccagctgcggt
atcaagtcccctcaaagctgcggagtaatcgagaggccccccagcaccaaccagcagcag
cagcaacctcagtcgcagaaaaaggttccccagcaaccgccgcagcaaacccccaatcct
caatcccaaccttcagcgccgccgccaccacagcaacaggcattgtcccagtgcagcatg
ggcaacggtttcgcctccacacccatgatcatggagatcccagaaagcggagggggcgga
ggaggaggccgtgccatatacgagcggatgagccaggacttcggcacagggagctaccct
cagtccacggccactttcagcctggcgaagctccaacagctcaccaacactatcatggac
ccacacgccatgccctactcgcactctgcctccgtcacgtcgtacgccaccagcgtctcc
ctgtccaacccaggcctggccccctcgccccacgcccttcctcaaggccagcccaccatg
acctcaccggccaacctcagctccggctccatgaacctgggctcgctgcagctgcagtgc
aacatgccggccaccaacatcagcctgggtcctccgcagtcgcacaggttgcaggggcag
atggccacggtcaaaggccacatctccatccgctccaaagccacgcagcagctggcgcca
gcctcgcatcagcagcagctctacggccgcagctcggccatgcagggcacaacccggacg
ctgacagtgcagcgcggcatgatgcccaacctcatgcccacgccggcgccgtacaactcc
atgaacatgacgcccctgaacgccatgtcggccggttacagaatgccgcagagtatgatg
aacagcggttaccacagcaaccccccctacatgaaccagccagcgcagtacccaatgcag
atgcagatgggcatgatgggagggcagggttacccccagcagcctatgcagcccaatcac
catagcaacatgatgtacacgggcccttcccaccacagctacgctggcgtcccgaaacag
tcgccgtacatgagcagatga

DBGET integrated database retrieval system