KEGG   Xiphophorus maculatus (southern platyfish): 102221588Help
Entry
102221588         CDS       T02923                                 

Definition
histone acetyltransferase KAT6A-like
Orthology
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102221588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 2225 aa AA seqDB search
MVKLANPVYTQWILEAIKKVKKQKQRPSEERICNAVSMSHSLDRKTVLEQLELSVKDGTI
LKVTNKGLNSYKDPDNPGRLSLPKPKGSGGAGGGVAASAGGGSNNGACGTSHSHSGKKPG
LDWNKLIKRALEGLHEPGGSSLKNVERFLKCQADVAAYLSSSGSIGAGLFHQQLRVALKR
AVAHGRVVKQGQTFQLVSRGGCQNDGTGTVSLETLPPVRLLPHEKDKPVAEPIPICSFCL
GTKEQNRDKKPEELISCADCGNSGHPSCLKFSPELTARVKALWWQCIECKTCSSCQDQGK
NADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICQPRNKGKTLLHEKAAQIKRRYNA
PLGRPKNRPGRPFKKLGGRGRRKRSTSANSSSSSSCEGYPGDDRLLFSMRGDDEQSNSSL
HFNSKTKGLIDALTKFFTPSPAGRKARQEVVDYSQQCRIRKKAGRKGEGDDGDNQDGSDW
REDEDKLPGHENLTEKDIELFKHIQELALQKVGVTGPPDPQMRCPSVIEFGKFEIQTWYS
SPYPQEYSRLPKLYLCEFCLRYMKSRSILYQHMKKCSWFHPPANEIYRKDKVSVFEVDGN
VSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDNKGCHLVGYFSKEKHCQQKYNV
SCIMILPQYQRKGYGRFLIDFSYLLSKREGQPGSPEKPLSDLGRLSYMAYWRSVVLECLH
EVRDRQLTIRQLSKKTGICPQDITTTLHSLNMLEQRGDRLVLVRREKVVANHMARLKARP
RQLEVDPECLRWTPVIVTNTVVSETDGEEEEEDDEGPDDGIHKGMKLSHKVPTTPWQMQQ
RVEDEETKGFLGFPINQSTPASPSVHGPPSVPDPAHPPLPTNGERRPRGRPPKNCPWGKI
KNSTRVGRPPKIRPMEDEDDEDDEILEEGRTAGSSSSPPSLFSMDRQGDSSAFHSLDLAR
HPSITPTTRRGRPPRKKRGPKPRLPDGTGEGLTQSVLFRLNEAASVSKSCFSESSDDEEE
DDDEDDEEERGCSPPILTKPAIGLKCKKPLKRPRFRRSSHPQSSVVTETISETTEVLDEP
FVDSDSERPMPRLVEETSLGHPLRRYPPARSALRLSEPTPKRARHSNLSDSEEDDLTPVL
SVSALAARPSELPMVNPEVPVKKKKGWPKGKSRKPQWAKCDPGKPPGGGPNQEGGQIQSR
DLHTPKIKMKPGRKPRGWYLQREEAEKQEKERQRLDKDSQLLQGEDHTTASLRLGETDKQ
KDSDDDDYFPKPTEQKVPKRRGRPPKNRSIHLPPQPAPKPPPTSEPDEEDEEDDDEDTET
AWVDDKPSRPPSRPLLSPSSSSSASGPRAQHSQPHDAEVADGQDDDDNEDREEEESGSMG
SGGSSVTRRMAVTPGSGSRRSEEHDADDEGDGHLEDKSNSCKSRKRQDSDDEEDEEDEED
EDEPTSRPNSPPVKEEPQGGEAFLDMDNSVVPSYVSKQEEDEEEEEAEKEVQEAKSPPPS
ADPVQEERRRREQEESAAAAAAVETVTAMAVPSENMQLESLHPDDKDVTLLMEPQHAHSH
PHQHAEYKEELGQHHPHHQHQHSNELDLETMQAVQSLTQGEVQEEEAEPQPHHGAYQDCE
ETLAACRTLQSYSHTGENEEEGLPLVEECGASQHSSPLPNPPVPPLPNQSVRSVNSPGMS
SGVVESTPAGQRGGTPGPAGSTGSSTGSGYTQITPEHPSSLSAPSQQNMETSPMMDVPSV
SDHSQQVVDSGFSDLGSIESTTENYDNPSSYDSTMGGGGGNGTGNGGNGGAMSGAVVAGP
SATTSSSSSSTSATPSSSSTQSNSCSFVQTPSLTPSTANGGSQLGMGSCSLIQQTGPGAS
NTVPQPPPPPPPSNTPSCGISSPSSCGVIERPPSTNQQQQQPQSQKKVPQQPPQQTPNPQ
SQPSAPPPPQQQALSQCSMGNGFASTPMIMEIPESGGGGGGGRAIYERMSQDFGTGSYPQ
STATFSLAKLQQLTNTIMDPHAMPYSHSASVTSYATSVSLSNPGLAPSPHALPQGQPTMT
SPANLSSGSMNLGSLQLQCNMPATNISLGPPQSHRLQGQMATVKGHISIRSKATQQLAPA
SHQQQLYGRSSAMQGTTRTLTVQRGMMPNLMPTPAPYNSMNMTPLNAMSAGYRMPQSMMN
SGYHSNPPYMNQPAQYPMQMQMGMMGGQGYPQQPMQPNHHSNMMYTGPSHHSYAGVPKQS
PYMSR
NT seq 6678 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagctggccaacccggtttacacccaatggatcctagaggccattaagaaggtc
aagaagcagaagcagcgaccgtcggaggagcgcatttgcaatgcggtgtcgatgtcccac
agtttggaccgcaagacagttctggagcagctggagctcagcgtcaaggacggcaccatc
cttaaggtcaccaacaagggcctcaactcctacaaagacccagacaaccctgggcgcttg
tctctgccgaagccaaaaggcagcggcggcgcaggaggtggtgtagctgcatcagcggga
ggcggcagcaataatggcgcctgcggcacgtctcattcgcactccggcaagaaacccgga
ctcgactggaacaagctgatcaagcgggcactggagggcctccacgaacccggcggctcc
agcttgaaaaacgtggagcgcttcctgaagtgccaggcggacgtggcggcctacctgtcg
agcagcggctccataggagccggcctcttccaccagcagctgagggtggctctgaagaga
gcggtggcgcacggccgcgtggtcaagcaggggcagaccttccagctggtgagccgcggc
ggctgccagaacgacgggactgggacggtgtctctggaaacgctgccgcccgttcgactg
cttcctcatgagaaggacaagcccgtggcggagcccatccccatctgcagcttctgtctg
gggaccaaggagcagaaccgcgacaagaagccggaggagctcatctcctgcgccgactgc
ggcaacagcggccacccgtcctgcctcaagttttccccagagctcacggcacgagtcaaa
gctctgtggtggcagtgcatcgaatgcaagacctgcagcagctgtcaggatcaggggaag
aatgcggataacatgttgttctgtgattcttgtgaccggggcttccacatggagtgctgc
gatccgcctctcacacggatgcccaaaggcatgtggatttgtcaaatctgccaacccagg
aataagggaaagacgcttctgcacgaaaaggcggcgcagatcaaacggcgatacaacgcg
ccgctggggcggcccaagaacagaccagggcgacccttcaagaagctgggaggccgaggt
cggaggaagcgctccacctcggccaactcttcctccagctcctcttgcgaaggttacccc
ggcgatgaccggctacttttttcgatgcgcggggacgacgagcagtccaacagcagcctg
cacttcaacagcaagaccaagggcctcatcgacgccctcaccaagttcttcacgccgtcg
ccggcgggccgcaaggcgcggcaggaggtggtggactactcgcagcagtgccgcattcgg
aagaaggcggggcggaaaggagaaggagatgacggggacaatcaggacggcagcgactgg
cgggaggacgaagacaaactgcccggacacgagaacctgacagaaaaagacattgaactg
ttcaaacatatccaggagctggcgcttcagaaagttggcgtgactggtccaccagaccca
cagatgcgctgtccgtcagtcattgaatttggcaagtttgaaatccagacctggtactcg
tctccgtacccgcaggagtacagcaggctccccaaactatacctgtgtgagttctgcctg
cgctacatgaagagccgcagcatcctctaccagcacatgaagaagtgcagctggttccac
cctccggccaacgagatctacaggaaggacaaggtttctgtttttgaggtcgatggaaat
gttagcacaatctactgtcagaacctgtgtctgctggccaagctgttcctggaccacaag
accctttactatgacgtcgagcccttccttttctacgtcctcacgcagaacgacaacaaa
ggttgccatctggtcggctacttctccaaggagaagcactgtcaacagaaatacaatgta
tcatgcatcatgattcttccacaataccagcgcaagggctacggacgctttctcatcgac
tttagctacctgctgtcaaaacgggaagggcaacccggctccccggaaaagcctctgtcg
gacctgggccggctgtcctacatggcgtactggcgcagcgtggtgctggagtgtctccac
gaggtccgcgaccggcagctcaccatacggcagctcagcaagaagacgggcatctgcccg
caggacatcaccaccaccctgcacagcctcaacatgctggagcagcgaggagacaggctt
gtgttggtgcgaagggaaaaagtggtggccaaccacatggctcgcctcaaggctcggccg
cggcagctggaagttgaccccgagtgtctccgctggacaccggtcattgtcacaaacaca
gtcgtctcagaaacggatggagaggaggaagaggaggacgacgaaggaccagacgatggc
attcataaggggatgaaactaagccacaaggttccaacaacaccctggcagatgcagcag
agagtggaggatgaagaaacgaagggcttcctggggtttcccatcaaccaaagcacccca
gcttccccgtccgtccatggcccgccgtctgtcccagacccggcgcaccctcctctgccg
acgaacggcgagcgtcggccgcggggtcgtccacccaaaaactgcccctggggcaagata
aagaatagcacgcgcgtcggacggccacccaagatccgccccatggaagacgaggacgat
gaagacgatgagattctggaggagggccggacggctggctcttcgagcagcccaccgtcc
cttttctccatggatagacaaggagactcctcagcttttcactctctggacttggcgagg
cacccttccataacccctacgacgcgaagagggcgaccgccgagaaagaagaggggcccg
aagcctaggcttccagacgggaccggggaggggctgacacagtcggtcctgttcaggtta
aacgaagcggcgtccgtcagcaagagctgcttcagcgagagcagcgatgacgaggaggag
gatgacgacgaagatgacgaggaggagaggggatgctccccgcccatcctcaccaagcca
gcaatagggctcaaatgcaagaagcccctaaagaggcctcgttttcgtcggagcagtcac
ccacagagcagcgtggtgacagagaccatttccgagacgacggaggtgttggatgagccc
tttgtagactcagactccgagaggcctatgcccagacttgtagaggaaacgtccctgggc
cacccactgcgtcgctaccccccagcgagatctgctctgagattgtctgagccaacaccc
aagagagctcgccactccaacctctctgattcagaggaagatgatctaacacctgtgctg
agtgtatccgctctggcagcgaggccatcagagttacctatggtcaaccccgaggtccct
gtcaagaagaagaagggttggccaaaaggaaagagccgcaaaccgcagtgggcgaaatgc
gatcccgggaaaccccccggtggtgggcctaaccaagaaggcggccagatccaaagcaga
gatttgcacacccctaaaatcaaaatgaagcctggccgcaagccgcggggctggtacctt
caacgggaggaggctgagaagcaggagaaggaaagacagcggctggacaaagactcccag
ctgctccagggagaggatcacactaccgcaagtctgcgactcggcgaaactgacaaacaa
aaagactcggacgatgacgactacttccctaagcctaccgaacaaaaagtgcccaaaagg
cgagggaggccgccaaagaaccgttccattcacctgccaccgcagcctgcccccaagcct
ccacccacctccgagccggacgaagaggatgaagaagacgacgatgaggacactgaaacc
gcatgggtggacgacaagcccagccgtccaccatcccgtcccttactgtccccctcgtct
tcctcgtctgcgtcagggccacgggcccaacattcccaaccccacgacgcagaggtagct
gacgggcaggacgatgacgacaacgaagacagggaagaagaggaaagtggcagcatgggc
agcggaggcagcagcgtcaccaggcgaatggccgtcacaccgggttccggcagcaggcgg
agcgaagagcacgacgcggatgacgaaggtgacgggcatttagaagacaagagcaacagc
tgcaagtcgagaaaaagacaagattcggatgacgaagaagacgaagaggatgaggaggac
gaggacgagcccacctctcggccaaactctcctccggtcaaagaagaaccccaaggtggc
gaggcttttttagacatggacaacagcgtggtgccaagctatgtcagcaagcaggaggaa
gacgaggaggaggaggaggctgagaaggaggtgcaggaagccaagtctccgcctccttcc
gccgaccccgtgcaggaggagaggcggcgcagggagcaagaggagtcggccgcagcggct
gcagccgtggaaacagtcaccgctatggccgtcccttctgagaacatgcagctggagtcg
ctacacccggacgacaaagacgtcacgctgttgatggaaccccaacacgcacactcccac
ccacaccagcacgccgagtataaggaggagttgggccaacaccatccgcaccaccagcat
cagcattccaacgagctggacctggagacgatgcaggccgtgcagtcgctgacgcaagga
gaggtccaggaggaagaggcagagccgcagccccaccatggcgcttaccaagactgcgag
gagacactagctgcctgccggactctgcagagttatagccacacgggggagaacgaagag
gagggtctgcctttagtggaggagtgtggagcttcacaacatagcagcccactcccaaac
cctccagtgcctcctttgcccaaccagtctgttcgctcggtcaacagcccagggatgtct
tcaggtgtcgtggagagcacacctgccggacagaggggcggtacgccgggccccgccgga
tccacaggcagcagcaccggcagcggctacacccaaatcactccagaacacccgagctca
ctgtctgccccatcccagcagaacatggagacttctccgatgatggacgtgccgtcggtg
tcggaccactcgcagcaggttgtggacagtggcttcagcgacctgggcagcatcgagagc
acgacagagaattacgacaaccccagcagctacgactccactatgggcggcggagggggc
aacggaacaggaaatgggggtaatggaggggcgatgtcgggcgccgttgtggcaggaccc
tccgccacaacgtcatcttcctcctcctccacctctgccactccatcgtcctcgtctacg
caatccaacagttgctcctttgtgcagactcccagcctcacaccctccacagccaatggg
gggtcccagttgggaatgggcagctgtagcctcatccagcaaactggaccaggagctagt
aacaccgtgccgcagcctccgccacccccacctccttccaacacccccagctgcggtata
tcaagtccctcaagctgcggagtaatcgagaggccccccagcaccaaccagcagcagcag
caacctcagtcgcagaaaaaggttccccagcaaccgccgcagcaaacccccaatcctcaa
tcccaaccttcagcgccgccgccaccccagcaacaggcattgtcccagtgcagcatgggc
aacggtttcgcctccacacccatgatcatggagatcccagaaagcggagggggcggagga
ggaggccgtgccatatacgagcggatgagccaggacttcggcacagggagctaccctcag
tccacggccactttcagcctggcgaagctccaacagctcaccaacactatcatggaccca
cacgccatgccctactcgcactctgcctccgtcacgtcgtacgccaccagcgtctccctg
tccaacccaggcctggccccctcgccccacgcccttcctcaaggccagcccaccatgacc
tcaccggccaacctcagctccggctccatgaacctgggctcgctgcagctgcagtgcaac
atgccggccaccaacatcagcctgggtcctccgcagtcgcacaggttgcaggggcagatg
gccacggtcaaaggccacatctccatccgctccaaagccacgcagcagctggcgccagcc
tcgcatcagcagcagctctacggccgcagctcggccatgcagggcacaacccggacgctg
acagtgcagcgcggcatgatgcccaacctcatgcccacgccggcgccgtacaactccatg
aacatgacgcccctgaacgccatgtcggccggttacagaatgccgcagagtatgatgaac
agcggttaccacagcaaccccccctacatgaaccagccagcgcagtacccaatgcagatg
cagatgggcatgatgggagggcagggttacccccagcagcctatgcagcccaatcaccat
agcaacatgatgtacacgggcccttcccaccacagctacgctggcgtcccgaaacagtcg
ccgtacatgagcagatga

DBGET integrated database retrieval system