KEGG   Xiphophorus maculatus (southern platyfish): 102221720Help
Entry
102221720         CDS       T02923                                 

Definition
histone acetyltransferase KAT2B-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:xma00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102221720
Enzymes [BR:xma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102221720
Transcription machinery [BR:xma03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102221720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 793 aa AA seqDB search
MADSVGIQQGSPAVGAAGLVPAAPGAAGTEGSSAAGGSARIAAKKAQLRSSPRPKKLEKL
GVYSSCKAEGACKCNGWKSQNPPPTPPQTDQQSNTVNLQEPCRSCSHTLGDHVTHLENVS
EEEMNRLLGVVLDVEYLYTCVHKEEDADTKQVYFSLFKLLRKSILQMGKPMLEAQESPPF
EKPSIEQGVNNFVQYKFSHLPSKERQTIMELAKMFLNQINYWQLETPSQRRQRVPSDDVV
GYKVNYTRWLCYCNVPQFCDSLPRYETTQIFGRTLLRSVFTVMRKQLLEQARQEKDKLPP
EKRTLILTHFPKFLSMLEEEVYSHSSPIWSQDFLVGATGGQIPVHTVISAPPVARPIYYS
TSPVSVDPSTCGSVSPARKPASVLESNPGEKRKASEPLHHEENKRPKVVGDIPMDLINEV
MATISDPATIPETSLLSAHSARDEAARLEERRGVIEFHVIGNSLNQKPNKRILMWLVGLQ
NVFSHQLPRMPKEYITRLVFDPKHKTLSLIKDGRVIGGICFRMFPSQGFTEIVFCAVTSN
EQVKGYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKKQGFSKDIKVPKAKYVGYIKD
YEGATLMGCELNPSIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIP
IESIPGIRETGWKPAGKGXEKELKDPDQLYSTLKTILQHVKNHQNAWPFMEPVKKTEAPG
YYQVIRFPMDLKTMSERLKSRYYTTRKLFMADMQRIFTNCREYNAPESEYYKCANILEKF
FYTKIKEAGLIEK
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atggccgacagcgtggggattcaacaaggttcgccggccgtcggagccgcgggcctggtt
ccggccgctcccggagccgcggggacggagggctccagcgccgctggaggatctgcacgt
atagccgcgaagaaggcgcaactccgctcctcaccacggccgaagaaactggaaaaactc
ggggtgtattcgtcctgtaaagctgaaggagcctgtaaatgtaatggctggaaaagtcag
aacccgcctccgacacctcctcaaactgaccagcaatccaacacagtgaacttacaggaa
ccttgtcggagctgttctcacacgttaggtgatcacgtgacccatcttgaaaatgtttca
gaggaggaaatgaacagactactaggtgttgttttggatgtggagtatctctacacctgt
gttcacaaggaggaggatgctgacaccaaacaagtctacttctccctcttcaaactgttg
agaaaatctatcctacagatgggtaagccgatgttagaggcacaagagagtccgccgttt
gaaaagcccagcattgagcagggagtgaataatttcgtccagtacaaattcagccaccta
ccgtcaaaggaacgacaaactatcatggagctggccaagatgttcctgaatcagatcaac
tactggcagctggaaactccctctcagagacgccaaagggtgcccagtgacgacgtggtt
ggatacaaagtcaactacaccagatggctctgctactgcaatgtgccgcagttctgcgac
agcttaccgcgctacgagaccacgcagatcttcggccggacgttgctgcgctccgtgttc
actgtgatgagaaagcagctgctggagcaggccagacaggagaaggacaagcttcctcct
gagaaacgcactctcattctcacacactttcccaaattcctgtccatgttggaagaggaa
gtttacagtcacagctctcccatctggagccaagacttcttggtgggagcaacaggaggg
cagattcctgtccacacagtgataagtgctcccccagtcgccagacccatatactacagc
accagtcccgtgtcagtggacccgtccacttgtggaagtgtgagccctgccaggaaaccc
gcctctgttctggagtcaaacccaggagaaaagcgaaaagcctcagagccgcttcaccat
gaagagaacaagagacccaaggtggtaggggacatccccatggacctcatcaatgaagtc
atggcaaccatcagtgaccctgccaccattccagagacgagtctgctgtctgctcattct
gcccgcgatgaagccgcccgcctcgaagagcggagaggagttatcgaattccacgtcatc
gggaactcgctcaatcagaagcccaacaagcggatcctgatgtggctcgttggccttcag
aacgtcttctcccaccagcttccccggatgcccaaagagtacataacccgactggtcttt
gacccgaaacataaaacgctgtctttgataaaagatggccgggtcattggagggatctgt
ttcaggatgttcccatcgcagggcttcacagagattgtattttgtgccgtcacgtccaat
gagcaagtcaagggttatgggacccatttaatgaaccacctaaaggaatatcacataaaa
cacgagatactgaacttcctcacttatgctgacgagtacgcaattgggtacttcaagaaa
cagggtttttcaaaggacatcaaggtccccaaagccaagtacgtgggctacatcaaggac
tacgagggagccacgctgatgggatgtgaactcaaccctagcatcccctacacagagttc
tccgttatcatcaagaagcagaaggagatcatcaagaagctgatagaaaggaagcaggcc
cagatccgaaaggtctacccggggctgtcctgttttaaggacggggtccggcagattcca
atcgagagcattcccggcatacgtgaaactggctggaagcctgcaggaaaggggtaagag
aaggaattgaaggaccctgaccaactttacagcacattgaaaaccatcctgcagcatgtg
aagaatcatcagaacgcctggcctttcatggagcctgtgaagaaaacagaagcacctggc
tactaccaagtcattcgtttcccgatggacttgaagacgatgagcgagcgcctgaagagc
aggtactacacgacgcggaagcttttcatggccgacatgcagcgcatcttcaccaactgc
cgcgaatacaacgctccggagagcgagtactacaagtgtgccaacatactggagaaattc
ttctacaccaagatcaaagaggcaggcctcatcgagaagtag

DBGET integrated database retrieval system