KEGG   Xiphophorus maculatus (southern platyfish): 102221720Help
Entry
102221720         CDS       T02923                                 

Gene name
kat2b
Definition
(RefSeq) K(lysine) acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:xma00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102221720 (kat2b)
Enzymes [BR:xma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102221720 (kat2b)
Transcription machinery [BR:xma03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102221720 (kat2b)
Chromosome [BR:xma03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102221720 (kat2b)
   HAT complexes
    PCAF complex
     102221720 (kat2b)
    STAGA complex
     102221720 (kat2b)
    TFTC complex
     102221720 (kat2b)
    SAGA complex
     102221720 (kat2b)
    SLIK complex
     102221720 (kat2b)
    ADA-HAT complex
     102221720 (kat2b)
    HAT-A2 complex
     102221720 (kat2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 792 aa AA seqDB search
MADSVGIQQGSPAVGAAGLVPAAPGAAGTEGSSAAGGSARIAAKKAQLRSSPRPKKLEKL
GVYSSCKAEGACKCNGWKSQNPPPTPPQTDQQSNTVNLQEPCRSCSHTLGDHVTHLENVS
EEEMNRLLGVVLDVEYLYTCVHKEEDADTKQVYFSLFKLLRKSILQMGKPMLEAQESPPF
EKPSIEQGVNNFVQYKFSHLPSKERQTIMELAKMFLNQINYWQLETPSQRRQRVPSDDVV
GYKVNYTRWLCYCNVPQFCDSLPRYETTQIFGRTLLRSVFTVMRKQLLEQARQEKDKLPP
EKRTLILTHFPKFLSMLEEEVYSHSSPIWSQDFLVGATGGQIPVHTVISAPPVARPIYYS
TSPVSVDPSTCGSVSPARKPASVLESNPVGEKRKASEPLHHEENKRPKVVGDIPMDLINE
VMATISDPATIPETSLLSAHSARDEAARLEERRGVIEFHVIGNSLNQKPNKRILMWLVGL
QNVFSHQLPRMPKEYITRLVFDPKHKTLSLIKDGRVIGGICFRMFPSQGFTEIVFCAVTS
NEQVKGYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKKQGFSKDIKVPKAKYVGYIK
DYEGATLMGCELNPSIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQI
PIESIPGIRETGWKPAGKGKELKDPDQLYSTLKTILQHVKNHQNAWPFMEPVKKTEAPGY
YQVIRFPMDLKTMSERLKSRYYTTRKLFMADMQRIFTNCREYNAPESEYYKCANILEKFF
YTKIKEAGLIEK
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atggccgacagcgtggggattcaacaaggttcgccggccgtcggagccgcgggcctggtt
ccggccgctcccggagccgcggggacggagggctccagcgccgctggaggatctgcacgt
atagccgcgaagaaggcgcaactccgctcctcaccacggccgaagaaactggaaaaactc
ggggtgtattcgtcctgtaaagctgaaggagcctgtaaatgtaatggctggaaaagtcag
aacccgcctccgacacctcctcaaactgaccagcaatccaacacagtgaacttacaggaa
ccttgtcggagctgttctcacacgttaggtgatcacgtgacccatcttgaaaatgtttca
gaggaggaaatgaacagactactaggtgttgttttggatgtggagtatctctacacctgt
gttcacaaggaggaggatgctgacaccaaacaagtctacttctccctcttcaaactgttg
agaaaatctatcctacagatgggtaagccgatgttagaggcacaagagagtccgccgttt
gaaaagcccagcattgagcagggagtgaataatttcgtccagtacaaattcagccaccta
ccgtcaaaggaacgacaaactatcatggagctggccaagatgttcctgaatcagatcaac
tactggcagctggaaactccctctcagagacgccaaagggtgcccagtgacgacgtggtt
ggatacaaagtcaactacaccagatggctctgctactgcaatgtgccgcagttctgcgac
agcttaccgcgctacgagaccacgcagatcttcggccggacgttgctgcgctccgtgttc
actgtgatgagaaagcagctgctggagcaggccagacaggagaaggacaagcttcctcct
gagaaacgcactctcattctcacacactttcccaaattcctgtccatgttggaagaggaa
gtttacagtcacagctctcccatctggagccaagacttcttggtgggagcaacaggaggg
cagattcctgtccacacagtgataagtgctcccccagtcgccagacccatatactacagc
accagtcccgtgtcagtggacccgtccacttgtggaagtgtgagccctgccaggaaaccc
gcctctgttctggagtcaaacccagtaggagaaaagcgaaaagcctcagagccgcttcac
catgaagagaacaagagacccaaggtggtaggggacatccccatggacctcatcaatgaa
gtcatggcaaccatcagtgaccctgccaccattccagagacgagtctgctgtctgctcat
tctgcccgcgatgaagccgcccgcctcgaagagcggagaggagttatcgaattccacgtc
atcgggaactcgctcaatcagaagcccaacaagcggatcctgatgtggctcgttggcctt
cagaacgtcttctcccaccagcttccccggatgcccaaagagtacataacccgactggtc
tttgacccgaaacataaaacgctgtctttgataaaagatggccgggtcattggagggatc
tgtttcaggatgttcccatcgcagggcttcacagagattgtattttgtgccgtcacgtcc
aatgagcaagtcaagggttatgggacccatttaatgaaccacctaaaggaatatcacata
aaacacgagatactgaacttcctcacttatgctgacgagtacgcaattgggtacttcaag
aaacagggtttttcaaaggacatcaaggtccccaaagccaagtacgtgggctacatcaag
gactacgagggagccacgctgatgggatgtgaactcaaccctagcatcccctacacagag
ttctccgttatcatcaagaagcagaaggagatcatcaagaagctgatagaaaggaagcag
gcccagatccgaaaggtctacccggggctgtcctgttttaaggacggggtccggcagatt
ccaatcgagagcattcccggcatacgtgaaactggctggaagcctgcaggaaaggggaag
gaattgaaggaccctgaccaactttacagcacattgaaaaccatcctgcagcatgtgaag
aatcatcagaacgcctggcctttcatggagcctgtgaagaaaacagaagcacctggctac
taccaagtcattcgtttcccgatggacttgaagacgatgagcgagcgcctgaagagcagg
tactacacgacgcggaagcttttcatggccgacatgcagcgcatcttcaccaactgccgc
gaatacaacgctccggagagcgagtactacaagtgtgccaacatactggagaaattcttc
tacaccaagatcaaagaggcaggcctcatcgagaagtag

DBGET integrated database retrieval system