KEGG   Xiphophorus maculatus (southern platyfish): 102222338Help
Entry
102222338         CDS       T02923                                 

Gene name
kat2a
Definition
(RefSeq) K(lysine) acetyltransferase 2A
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:xma00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102222338 (kat2a)
Enzymes [BR:xma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102222338 (kat2a)
Transcription machinery [BR:xma03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102222338 (kat2a)
Chromosome [BR:xma03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102222338 (kat2a)
   HAT complexes
    PCAF complex
     102222338 (kat2a)
    STAGA complex
     102222338 (kat2a)
    TFTC complex
     102222338 (kat2a)
    SAGA complex
     102222338 (kat2a)
    SLIK complex
     102222338 (kat2a)
    ADA-HAT complex
     102222338 (kat2a)
    HAT-A2 complex
     102222338 (kat2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 797 aa AA seqDB search
MSDPATQALQPRLLQAQSSGSAGSGAAAAGSGTGNSDPVRPGLSQQQRASQKKAQVRAFP
RAKKLEKLGVFSACKASDTCKCNGWKNPNPPSATRIDLQQQAASLSEPCRSCGHALADHV
SHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMSQPVVE
GSLGSPPFEKPNIEQGVLNFVQYKFSHLAPRERQTMFELSKMFLICLNYWKLETPTQYRQ
RTQKDDATAYKLDYTRWLCYCHVPQSNDSLPRYETTQVFGRNLLKSIFTVTRRQLLEKFR
VEKDKLLPEKRTLILTHFPKFLSMLEEEIYGENSPIWEADFTMPASESTQIGHQTVISPA
SASGSPALSKCLNSSSSLGSTDTGGVEPITGDKRKLPEALTLEDAKRIRVMGDIPMELVN
EVMMTITDPAAMLGPETNLLTPNAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWL
VGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCA
VTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKGRYLG
YIKDYEGATLMECELNPRIPYTELSHIIKRQKEIIKKLIERKQSQIRKVYPGLTCFKEGV
RQIPVESIPGIRETGWKPNSKDKGKEVKDPDVLYNMLKNLLAQIKAHPDAWPFMEPVKKS
EAPDYYEVIRFPIDLKTMTEKLKNRYYVTKKLFIADLQRIISNCREYNPPDSEYCKCANT
LEKFFYFKLKDGGLIEK
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacccggctacacaggccttacagccccggcttctccaagcccagtcgagcggc
tcagcgggatccggtgctgcagcagcaggctccggtacagggaacagcgacccggttaga
ccaggacttagccagcaacagcgtgcgagccaaaagaaagcccaagtccgagcttttcca
cgggcgaaaaagcttgagaaacttggcgtattctccgcgtgcaaggccagtgacacatgc
aagtgcaatggatggaaaaacccaaaccccccttcagctacacggattgatctgcagcag
caagcagccagtctgagcgagccctgccgcagctgtggacatgcactggctgatcatgtg
tcccatctggagaatgtgtctgaggatgagattaacaggctgttggggatggtggttgat
gtcgagaaccttttcatgtctgtacacaaagaagaggacactgataccaaacaagtgtac
ttctaccttttcaagctactgaggaaatgcatcctgcagatgagtcagcctgttgtggag
ggatccctgggaagtccgccgtttgaaaagcccaacatcgagcagggcgttttgaatttt
gtacagtacaagttcagccaccttgcgccaagggagagacagaccatgtttgaactatca
aagatgtttctcatatgtctgaattactggaagcttgagacaccgacgcagtatcgtcag
cgcacccagaaagacgatgcaacagcatacaagttggactacaccaggtggttgtgctac
tgccacgtcccgcaaagtaatgacagcctgcctcgctacgagaccacgcaggtgtttggc
cgaaacttactcaagtccatctttaccgttactcgccgccagctcttggagaagtttaga
gtggagaaggacaaactgctgccagagaaacgcacacttatccttacgcactttcccaag
ttcttgtcgatgctggaggaggaaatctacggggaaaattcaccgatatgggaggctgac
ttcaccatgcctgcctcagaaagcacacagattggacatcagacagtgatcagtcctgct
tcagcgtccgggtctcctgctttgtccaaatgtctgaacagctcctcctctctgggcagt
acggatacaggaggcgtagagcccatcacaggggacaaacgcaaacttccagaggcattg
acgctggaagatgctaagaggatccgtgtgatgggggacattcctatggagttggtgaat
gaagtcatgatgacgatcactgatcctgctgctatgctcggaccggagactaatctgctg
acacctaatgctgctcgtgacgagacagccagactagaagagagacggggcatcattgag
ttccacgttatcggaaactccctttcccagaagtccaacaagaagatcctgatgtggctt
gttggccttcagaacgtattttcccatcagttacctcgcatgcccaaagagtacataaca
cgactcgtgtttgacccgaagcacaaaaccttagccctcattaaagatggccgcgtcatt
ggaggcatctgttttaggatgttccccactcagggcttcacagagattgtgttctgtgct
gtcacatccaacgaacaagtcaagggctatggcacccacctgatgaaccacctgaaggaa
tatcacattaaacacaacatcctttatttcctcacttatgctgatgagtatgccattggc
tacttcaaaaagcagggtttttccaaagatatcaaagtgcccaagggtcgatacctgggc
tatatcaaagactatgagggagcaaccttgatggagtgtgagctaaacccaaggattccc
tacacagagctttcacacattattaaaagacagaaggagattataaagaagctgattgag
agaaaacagagtcagatcagaaaggtttacccaggtctgacctgcttcaaagagggtgtg
cgacagatcccagtggaaagcatccctggaataagagagacaggctggaaacccaatagc
aaggacaaagggaaagaggtgaaggaccctgatgtgctttacaacatgctgaagaacctt
ctggcacaaataaaggctcatcctgatgcttggcctttcatggaaccagtgaagaaatct
gaagctcctgattactatgaagtcatccgctttcctattgacctgaagaccatgacagag
aaactcaagaacagatactatgtaaccaagaagctctttattgcggatcttcagcgaatc
atcagcaactgtcgcgagtacaaccctccagacagcgagtactgcaagtgtgccaacacg
ttggagaagttcttctacttcaaattaaaagatggaggcctgatagagaaatga

DBGET integrated database retrieval system