KEGG   Xiphophorus maculatus (southern platyfish): 102222348Help
Entry
102222348         CDS       T02923                                 

Definition
general transcription factor 3C polypeptide 4-like
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102222348
Transcription machinery [BR:xma03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     102222348
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 771 aa AA seqDB search
MAAASPPDCATPESGNVAIKTEPLDGDDAPPTLRDVPVRRDPVVPLLSPVSGPQPLRWSP
DHRLSVCTSSSLSVLELLYDIHSSRLDLSLNRTSIPVPTQTHKLRVGPPDELSRAVKKFS
LDPDPTVRQVFLADTVINPSVGVHSGMKFASWSPLGCDSCGRCLLACLTLDNRLTVHSSR
GHLEWKLLADLSENYGERLKERGYAKKDSNPPQADLLDLAELQRRFRMQTPLKMEWSSVY
TIKKVQADNSCVDEEMVLLAVLMENGDLVLWKFVLPFADGDDVVFYDLIESGVSRPSDLA
WWEYENGNQRMGGLIVGSEVGPVKIMPVSLLKVKGYCTLRLPVILWKECDEIAVENIRCF
PVIHPIHKTSCSLIVASRGCYIFWCLLMVSPDGLNIHNSHITGLNSLPVVSLAVSQHEVA
VYSCSMDGWIKKLTPTFTESSVIFKVEDLVQPETLTGRRIHGIAVSHNGTYLALVSTAGI
VGSFHPIHKNFQIHFLTLKTPEAAASLLLKSPEQNLFKMADLLDLVKWQVLKTKRVPASL
QEELDRKLQEVDSPYLWRIKLFLARVLHLTLQVPRTENKWRPRRTAVKVLVQDEEEDEEE
AVERVEGEAGGVEGEAEARRTEIQTLMEAAETHLMRDHMKKVLGVVYLNTWVPQNICIPT
CGLMDYLSRDPNDKDSEVLIGHIRKKLNKQTFPEHCSLCQAPLPFTDWKQAACENGHVWL
RCVLSYQACQTLTFRRCLLQDCIARLPEPEDPEWIKKLLKAPCLLCDSPMI
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgccagtccgcctgactgtgctaccccggagtctggtaacgttgcgataaag
acggagcctttagacggggacgatgcgccgcccacgctgcgggacgtgccggttcgacgc
gacccggtggtgccgctgctgtccccggtgagcgggccgcagccgctccgctggtctccg
gatcaccggctgtccgtgtgcacctccagctccctgtccgtgctggagctgctctacgac
atccacagcagcagactggacctgagcctcaaccgaacctccatccctgtcccgacccag
acccacaagctgcgggtcggaccgccagatgagctgtcgcgtgctgtaaagaagttctcg
ttggatccggacccgactgtgcggcaggtctttctggcggacacggtgatcaacccatca
gtcggggttcacagtgggatgaagttcgccagctggtctccgctgggctgcgactcctgt
ggccgctgcctcctcgcctgcctaacgctcgataaccgactcaccgttcacagcagccgc
ggccacctggagtggaaactgctggccgatcttagcgagaattacggcgagcggctaaag
gagcgaggctacgccaagaaggatagcaaccccccacaggcggacctgttggacctcgcc
gagctgcagcggcggttccgcatgcagacccctttgaagatggagtggtcgagcgtttac
accatcaaaaaggtccaggcggacaacagctgcgtggatgaagagatggttctcctcgcc
gtcctgatggaaaatggcgacctcgttttgtggaagttcgtgctgccgttcgcggacggc
gacgacgttgtcttctacgacctcatcgagtccggcgtgagcagacccagcgacttggcg
tggtgggagtacgagaacggcaatcagcggatgggagggctaatcgtcggcagcgaggtt
ggacccgtcaagattatgccggtcagcctgttgaaagtgaagggctactgcacgctacgg
ctccccgtcatcctgtggaaggagtgcgacgagatcgcagtggaaaacatccggtgcttc
ccggtgatccacccgatccataaaaccagctgcagcctcatcgtcgcctcaaggggttgc
tacatcttctggtgtttgctgatggtttcaccagacggactcaacattcacaattcccac
ataacgggactcaactcgctgcctgtcgtctccttggcggtcagtcagcatgaagtcgcg
gtctactcctgctccatggacggttggatcaaaaaactgacgccgacgttcacggagagc
tccgttatcttcaaagtagaggacttggttcagccagagacccttacgggacggcggata
cacgggattgccgttagccacaacggcacataccttgctctggtcagcaccgcggggatc
gtcggtagcttccaccctatccacaagaacttccagatccacttcctgacgctgaaaact
cctgaagcggctgcatcgctcctgctcaagtcccccgagcagaacctgttcaaaatggcg
gacttgctcgacctggtgaagtggcaggtcctgaaaaccaaacgcgtcccggcgtcgctc
caggaggagctcgaccgcaaactccaggaagtggactcgccgtacttgtggcgcatcaag
ctctttttggcgcgcgttcttcacctgaccctgcaggtgccgcgcacagagaacaaatgg
agacccaggcggacggcggtcaaagtgttggtacaagatgaggaagaggacgaggaagag
gctgttgagagggtggaaggcgaggctggtggagttgaaggggaagcagaggcccgaagg
accgagattcagactctgatggaagcggctgagacgcatctgatgagggatcacatgaag
aaggttttgggcgtcgtgtatctcaacacctgggtgcctcagaacatctgcatccccacc
tgcggcctgatggactacctgtccagggatcccaacgacaaagattcagaggttctgatc
ggccacatccggaagaagctcaacaagcagacgttcccggagcactgcagcctctgtcaa
gccccgctgcccttcaccgactggaaacaagccgcctgcgaaaacggacacgtgtggctc
aggtgcgtgttgtcataccaggcctgccagacgctgacgttcagacgctgcctcctgcag
gattgcattgccagactgccagagcctgaggatccggagtggataaagaaactcctgaag
gcgccctgcctgctctgtgactcacccatgatctga

DBGET integrated database retrieval system