KEGG   Xiphophorus maculatus (southern platyfish): 102222791Help
Entry
102222791         CDS       T02923                                 

Definition
glutamate decarboxylase 2-like
Orthology
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    102222791
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102222791
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102222791
   00430 Taurine and hypotaurine metabolism
    102222791
Enzymes [BR:xma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     102222791
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 585 aa AA seqDB search
MASHGFWSLGGENAGANTGSQSPSTPRAWCQAAAQKLSGGIGSKLCALLNVGEGEKPAEP
AAMQPPQTAAGSCGCNKSCTCTKGTDVGFSDLYSTDLLPAMDGDTKTMTFLQEVVDILMA
YIVESFDRETKVIDFHYPNELLQLNNWELQDEPATLDDILISCRATLKYAIKTAHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEVAPVFVLLEYVTLKKMREIIGWADGRGDGIFS
PGGAISNMYAMLLARFKMFPEVKEKGMSSVPKLVAFTSEHSHFSIKKGAAALGIGTESVI
CIKADECGKLIPADLERRILEAKHKGFVPFFVSATAGTTVYGAFDPLIAISDICKKYNVW
FHVDGAWGGSLLMSRRHRWKLDGVERANSVTWNPHKMMSVPLQCSALLVREEGLMQSCNQ
MHACYLFQQDKQYDLSYDTGDKALQCGRHVDIFKLWLMWRAKGTIGFEAQIDKCLELSEY
LYNKIKDREGYQMVFDGKPQHTNVCFWYLPPGIRYMEDKEEKKKRLHKVAPVIKARMMEY
GTTMVSYQPQGDKVNFFRMVISNPAATFEDIDFLIEEIERLGHDL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgcacggcttctggtccctcggcggggaaaatgcgggggccaacaccgggagt
caaagccccagcacccccagggcttggtgccaagcagctgcccagaaattatccggagga
attggatcaaaattatgtgcgctgctaaatgtcggagaaggggagaaacccgccgagccg
gccgccatgcagccgccgcagaccgctgcgggaagctgcggctgcaacaaatcctgcacc
tgcaccaaaggcaccgatgtgggcttctcagacctctactcaacagacctgctgccagcc
atggacggagacaccaaaacgatgaccttcctgcaggaggtcgtggatattttaatggcc
tacatagtcgagtcgttcgaccgggaaacgaaagtgatcgattttcattatcccaacgag
ctgctgcagctgaacaactgggagcttcaggacgagccggccacgctggatgacatcttg
atcagctgccgcgcaactctcaaatacgccatcaaaacagcgcaccccaggtacttcaat
cagctctccacaggattagacatggtcgggctggcagccgattggctcacatccacggcc
aacaccaacatgttcacctatgaggtggcgcctgtgtttgtgctgctggagtacgtcacc
ttgaagaagatgagggagatcattggctgggcggacgggcgaggagacggcattttctca
ccggggggtgccatttccaacatgtacgctatgctgctggcccgcttcaagatgttccct
gaagtgaaggagaaaggaatgtcgtccgtccccaaactggtggccttcacatccgaacac
agccatttttccatcaaaaaaggagcggcggcgcttggcattggaactgaaagcgtgatc
tgcatcaaggcagacgaatgtggcaaactgatccccgccgacctggagaggagaatactg
gaggcgaaacacaaggggtttgtaccgttctttgtgagtgcgacagctgggacaaccgtg
tacggcgcctttgacccgctcatcgccatctctgacatctgcaaaaagtacaacgtctgg
tttcacgtggatggagcgtggggagggagtctgctcatgtcccggagacaccggtggaaa
ctggacggcgttgaaagggccaactctgtgacctggaaccctcacaaaatgatgtccgtc
cccctgcagtgctccgccctgctcgtcagagaggagggtttgatgcagagctgcaaccag
atgcacgcctgctacctcttccagcaggacaaacagtacgacctttcctacgacaccggg
gacaaagcgctgcagtgtggacgccatgtggacatcttcaaactctggctgatgtggaga
gcgaagggaaccatcggcttcgaagcccagattgacaaatgcttggagctgtcggagtat
ctgtacaacaaaatcaaagacagagaaggataccagatggtgttcgatgggaagcctcag
cacaccaacgtctgcttctggtacctccccccggggatccgctacatggaggacaaagag
gagaagaagaagcgccttcacaaggtggctccagtcatcaaagccaggatgatggagtac
ggcaccaccatggtcagctaccagccacaaggcgacaaggtgaacttcttccgcatggtg
atctccaaccctgctgctaccttcgaggacatcgacttcctcatcgaggaaatcgagcga
ctcggccatgatctataa

DBGET integrated database retrieval system